Tıbbi Terimler Kılavuzu

Türk Dil Kurumu tarafından 16 Aralık 2004 yılında kurulan “Tıp Terimleri Çalışma Grubu” 14 yılı aşkın süredir çalışmalarına kesintisiz devam etmektedir. Tıbbın farklı dallarından 12 hekim, 1 Türk dili uzmanı ve 1 bilim tarihçisinden oluşan grubun hazırladığı “Tıp Terimleri Karşılıklar Kılavuzu” 6754 terim içermektedir. Elinizdeki bu karşılıklar kılavuzuyla tıp terimlerinin Türkçede doğru yazılışına ve önerilen Türkçe karşılığına ulaşılabilmektedir. Terimler hem Türkçe hem de İngilizce olarak aranabilmektedir. Uygulamaya vereceğiniz geri bildirimlerle “Tıp Terimleri Karşılıklar Kılavuzu” daha da gelişecektir.

ARAMAK İSTEDİĞİNİZ TERİM VE KARŞILIĞINI “TERİM ARA” KUTUSUNA YAZARAK BULABİLİRSİNİZ



TerimEnglishTürkçe
a(n)-a(n)-yokluk, -sızlık ör. anüri, afebril
a.arteryarter, atardamar
AAAlcoholics AnonymousAdsız Alkolikler
AAA1. abdominal aortic aneurysm 2. familial Mediterranean fever1. abdominal aort anevrizması, karın ana atardamar balonlaşması 2. ailevi Akdeniz ateşi
ab-ab-uzağında ör. abdüktör
abaziabasiayürüyememezlik
abdomenabdomenkarın
abdominalabdominalkarın (ilişkili)
abdominal aortaabdominal aortakarın ana atardamarı
abdominokardiyak refleksabdominocardiac reflexkarın-yürek tepkesi
abdominoplastiabdominoplastykarın duvarı düzeltimi
abdüksiyonabduction1. dışa çekim 2. uzaklaştırma
abdüktörabductor1. dışaçeken 2. uzaklaştırıcı
aberanaberrantsapmış
aberasyonaberrationsapma
abeslangtongue depressordil basacağı
ABIankle-brachial indexayak bileği-kol göstergesi
abiliteabilityyeti
ablaktasyonablactationsütten kesme
ablasyo plasentaplacental abruption, ablatio placentaeerken döleşi ayrılması
ablasyonablationyok edim
ablatifablativeyok edici
ablefariablephary gözkapaksızlığı
ablüsyomani ablutiomaniayıkanma saplantısı
ablüsyon ablutionyıkanma, temizlenme
abondan abundantaşırı, bol
abortifabortive1. düşük yaptırıcı (ilaç, işlem). 2. hastalık seyrini kısaltan
abortusabortusdüşük
abortus imminens threatened abortion, imminent abortiondüşük tehdidi
abortus insipiensinevitable abortionkaçınılmaz düşük
ABPMambulatory blood pressure monitoringayakta kan basıncı izlemi
abrakiabrachiakolsuzluk
abrazivabrasivesıyırtıcı
abrazyonabrasionsıyrılma, sıyrık
abreaksiyonabreactiontepki yinelenmesiyle duygu boşalımı
absans nöbetiabsence seizuredalma nöbeti
absolü absolute salt
absolü eşikabsolute thresholdsalt eşik
absolü refrakter periyotabsolute refractory periodsalt yanıtsız dönem
absorbanabsorbantemici, soğurgan
absorbansabsorbancesoğurganlık
absorpsiyonabsorptionsoğurma, emilim
abstinansabstinence1. yoksunluk 2. perhiz
abstinans sendromuabstinence syndromeyoksunluk belirgesi
abuliabuliaistenç kaybı
ABYacute renal failureakut böbrek yetmezliği, ivegen böbrek yetmezliği
ACCaortic crossclampingaort çapraz kıstırgaçlama
ACEangiotensin converting enzymeanjiyotensin dönüştürücü enzim
ACLanterior cruciate ligamentanterior çapraz bağ, diz ön çapraz bağ
ACSacute coronary syndromeakut koroner sendrom, ivegen taçdamar belirgesi
ACTactivated clotting timeetkinleştirilmiş pıhtılaşma zamanı
ACTHadrenocorticotropic hormoneadrenokortikotropik hormon
AÇBposterior cruciate ligamentposterior çapraz bağ, diz arka çapraz bağ
ad-ad-bitişiğinde, yakınında ör. addüktör
ad libad libitumistendiği kadar, kısıtlamasız
adabtabiliteadaptabilityuyum yetisi
adaktiliadactilyparmaksızlık
adalemusclekas
adamantinadamantinediş minesi
adaptasyonadaptationuyum
adapteadapteduyarlanmış
adaptif davranışadaptive behavioruyumlu davranış
adaptöradaptoruyargaç
add-on therapyadd-on therapyeklemeli sağaltım
addüksiyonadduction1. içe çekim 2. yaklaştırma
addüktöradductor1. içeçeken 2. yaklaştırıcı
ADEangiotensin converting enzymeanjiyotensin dönüştürücü enzim
ADEMacute disseminated encephalomyelitisakut disemine ensefalomiyelit, ivegen yaygın beyin-omurilik yangısı
adenaljiadenalgiabez ağrısı
adenektomiadenectomybez çıkartma
adenitadenitisbez yangısı
adenofibromadenofibromabağsılaşmış bez uru.
adenohipofizadenohypophysis, anterior pituitary glandön hipofiz, ön sümüksü bez
adenoitadenoidgeniz eti
adenokarsinomadenocarcinomasalgı bezi kanseri
adenomadenomaiyicil bez uru
adenomatözadenomatousbez urumsu
adenomegaliadenomegalybez büyüklüğü
adenomiyomadenomyomabez-kas uru
adenomiyozis uteriadenomyosis uteridölyatağı kası iyicil uru
adenopatiadenopathy1. akkan bezi büyümesi 2. bez büyümesi
adenoreseptöradenoreceptorsalgı bezi almacı
adermiadermia derisizlik
adezivadhesiveyüzeye yapışkan
adezyonadhesionyüzey yapışması
ADHantidiuretic hormoneantidiüretik hormon
adinamiadynamiagüçsüzlük
adipo-adipo- yağ ör.adipozüri
adipoz dokuadipose tissueyağ dokusu
adipozozüriadiposuriayağlı idrar
adipsiadipsiasusamamazlık
aditif etkiadditive effecttoplam etki
adiyadokokineziadiadochokinesiaardışık devinimsizlik
adjuvanadjuvantartırgan
adneksaadnexaorgan ekleri
adneksa uteriadnexa uteridölyatağı ekleri
adneksitadnexitisadneks yangısı
adölesanadolescentergen
adölesansadolescenceergenlik
ADPadenosine diphosphateadenozin difosfat
adrenal adrenalböbrek üstü bezi
adrenarşadrenarchepubik-koltuk altı kıllanması
adsorbanadsorbentyüzergen
adsorpsiyonadsorptionyüzerme
adültadulterişkin
adventisyaadventitiazarsı katman
advers etkiadverse effectters etki
aer-aer-1.     hava (ilişkili) ör. aerofaji 2.oksijen (ilişkili) ör. aerobik
aerobikaerobic1. oksijenseven 2. havacıl
aerofajiaerophagiahava yutma
aerofobiaerophobiahava korkusu
aeropaerobeoksijenseven
aerosolaerosolpüskürtü
AFatrial fibrillationatriyal fibrilasyon, kulakçık çırpıntısı
afajiaphagiayutamamazlık
afakiaphakiamerceksizlik
afaziaphasialisan yitimi
afebrilafebrileateşsiz
afektaffectduygulanım
aferentafferentgetirgen
aferezapheresisayırseç
afetalafetaldölütsüz
afiliyasyonaffiliationbağlaşım
afiliyeaffiliatedbağlaşımlı (kurum)
afiniteaffinityçekim gücü
afokalafocalodaksız
afoniaphoniases yitimi
afrodizyakaphrodisiaccinsel uyarıcı (madde)
afterloadafterloadart yük
AGAappropriate for gestational agegebelik yaşına uygun (bebek)
agalaktiagalactiasütsüzlük
agamiagamieşeysiz üreme
agastriagastrimide yokluğu
AGEacute gastroenteritisakut gastroenterit, ivegen mide-bağırsak yangısı
ageneziagenesisdoğuştan yokluk
agiriagyriakıvrımsız beyin
aglomeratagglomeratekütlesel yığışım
aglosiaglossiadil yokluğu
aglütinasyonagglutinationkümeleşme
agnatiagnathiaçenesizlik
agnoziagnosiatanımazlık
agonadizmagonadismeşey bezsizlik
agoniagonycan çekişme
agonistagonistetkideş
agorafobiagoraphobiaaçık alan korkusu
agrafiagraphiayazamamazlık
agranülositagranulocytetaneciksiz akyuvar
agranülositopenigranulocytopeniataneciksiz akyuvar azlığı
agranülositozagranulocytosistaneciksiz akyuvar artışı
agreganaggregantyığıştırıcı
agregasyonaggregationyığışma
agregataggregateyığışım
agresifaggressivesaldırgan
agresif davranışaggressive behavioursaldırgan davranış
agresif tedaviaggressive treatmenthücum sağaltımı
agresif tümöraggressive tumorsaldırgan ur
agresiflik aggressivitysaldırganlık
agresyonaggressionsaldırı
agrometreaggregometeryığışımölçer
AGSManti-G straining maneuveryer çekimine karşı koyma manevrası
aguzi aguesiatat almamazlık
AIDSacquired immunodeficiency syndromeedinilmiş bağışıklık yetersizliği belirgesi
AIRDautoimmune inflammatory rheumatic diseaseotoimmün enflamatuvar romatizmal hastalık
ailurofobiailurophobiakedi korkusu
airwayairway1. havayolu 2. soluk yolu açarı
-aj-agedurum, birlikte olan ör. blokaj
ajanagentetken
ajitasyonagitation1. çalkalama 2. kışkırtı
ajitatöragitator1. çalkalayıcı 2. kışkırtıcı
ajiteagitated1. çalkalanmış 2. kışkırmış
ajite depresyonagitated depressionhuzursuz çökkünlük
akalazyaachalasiayemek borusu gevşemezliği
akalkuliacalculiahesap yapamamazlık
akantesteziacanthestesiaiğnelenme
akantositacanthocytetırtıklı alyuvar
akar fobisi acarophobiaakar korkusu
akardiacardiayürek yokluğu
akatiziakathisiayerinde duramazlık
AKBİambulatory blood pressure monitoringayakta kan basıncı izlemi
Akdeniz anemisiMediterranean anemia, thalassemiaAkdeniz kansızlığı
akeyriacheiriaelsizlik
akeyropodiacheiropodia, acheiropodyelsizlik ayaksızlık
akılmindus
akıl yürütmereasoninguslamlama, us yürütme
akinetopsiakinetopsiadevinim körlüğü
akineziakinesiadevinimsizlik
AKKaortic crossclampingaorta çapraz kıstırgaçlama
akkizacquirededinilmiş
aklüyofobiachluophobiakaranlık korkusu
akneacnesivilce
akolikacholicödsüz
akomodasyonaccommodationuyumsama
akondroplaziachondroplasiakıkırdak gelişmemezliği
akoriyaacoriadoymak bilmezlik
AKÖsudden cardiac deathani kardiyak ölüm, yürek kaynaklı ani ölüm
aköz aqueoussuda çözülmüş
akranpeeryaşdaş
akreditasyonaccreditationdenklik
akro-acro-1. uç ör. akromegali 2. tepe, zirve, yükseklik ör. akrofobi
akroesteziacroesthesiauç duyarlılığı
akrofobiacrophobiayükseklik korkusu
akromatopsiachromatopsiarenk körlüğü
akromegaliacromegalyuç irileşimi
akromiyonacromion omuz çıkıntısı
akronimacronymkısma ad
akroparesteziacroparesthesiauç karıncalanması
aksaxiseksen
AKSacute coronary syndromeakut koroner sendrom, ivegen taçdamar belirgesi
akselerasyonaccelerationivmelenme
akseleratöracceleratorivmelendirici
akselereacceleratedivmelenmiş
akselere hipertansiyonaccelerated hypertensionivmelenmiş yüksek kan basıncı
akseptansacceptancekabul yazısı
akseptöracceptoralıcı
aksesuaraccessoryek
aksillaaxillakoltuk altı çukuru
aksiller axillarykoltuk altı
aksisaxis 1. eksen 2. ikinci boyun omuru
aksiyelaxialeksensel
aksiyel düzlemaxial planeyatay düzlem
aksiyon potansiyeliaction potentialeylem gizil gücü
aksonotmezisaxonotmesisakson kesintisi
AKŞfasting blood glucoseaçlık kan şekeri
AKTallogenic blood transfusionalojenik kan transfüzyonu, türdeş kan aktarımı
aktifactiveetkin
aktino-actino-ışıksaçan ör. aktinoterapi
aktivasyonactivationetkinleşme
aktivatöractivatoretkinleştirici
aktiviteactivity 1. etkinlik 2. eylem
akua-aqua-su veya sıvı ör. akuaduktus
akuaduktusaqueductussu kanalı
akuafobiaquaphobiasu korkusu
akustik acousticsessel
akustik empedansacoustic impedanceses geçirimsizliği
akutacuteivegen
akut batınacute abdomenivegen karın
akut böbrek yetmezliğiacute renal failureivegen böbrek yetmezliği
akut faz reaktanıacute phase reactantivegen evre tepkiyeni
akut karınacute abdomenivegen karın
akut lenfoblastik lösemiacute lymphoblastic leukemiaivegen lenfoblastik kan kanseri
akut miyeloblastik lösemiacute myeloblastic leukemiaivegen miyeloblastik kan kanseri
akut respiratuvar distres sendromuacute respiratory distress syndromeivegen solunum sıkıntısı belirgesi
akut stres bozukluğuacute stress disorderivegen stres bozukluğu
-al-alilişkili ör. brakiyal
alawingkanat
alalialaliakonuşma yitimi
ALARAas low as reasonably achievedelde edildiği kadar düşük, olabildiğince düşük
ALARPas low as reasonably practicablemantıken uygulanabilir olanın en azı
albinizmalbinismakşınlık, akşın hastalığı
albinoalbinoakşın
albüminalbuminakprotein
ALCAPA anomalous origin of the left coronary artery from the pulmonary arterypulmoner atardamardan çıkan normal dışı sol taç atardamar
aldatılma delüzyonudelusion of jealousy aldatılma sanrısı
aleksialexiaokuyamamazlık
aleksitimialexithymiaduygu körlüğü
alelallelgen çifti
alerjenallergenduyarlatan
ALGantilymphocytic globulinantilenfositik globülin
algofobialgophobiaağrı korkusu
algolojialgologyağrı bilimi
algoritmaalgorithmakış basamakları
alimentasyonalimentationbesleme
alineasyonalineationyabancılaşma
aljezialgesia1.ağrıya aşırı duyarlılık 2. ağrı duyabilme
-alji-algia ağrı (ilişkili) ör. miyalji
alkalialkalibaz
alkalozalkalosiskan asitsizliği
ALKAPA anomalous origin of the left coronary artery from the pulmonary arterypulmoner atardamardan çıkan normal dışı sol taç atardamar
alkolikalcoholic1. alkol bağımlısı 2. alkol (ilişkili)
alkolik blackoutalcoholic blackoutalkolik bilinç kararması
alkolizmalcoholismalkol bağımlılığı
ALLacute lymphoblastic leukemiaakut lenfoblastik lösemi, ivegen lenfoblastik kan kanseri
alo-allo-türdeş, diğer ör. allograft
alogreftallografttürdeş yama
alojenik kan transfüzyonuallogenic blood transfusiontürdeş kan aktarımı,
alojialogiasöz yoksulluğu
alopesialopeciakellik
alopesi areataalopecia areatasaçkıran
alosensitizasyonallosensitizationtürdeş duyarlılaşma
alotransplantasyonallotransplantationtürdeş nakil
ALSamyotrophic lateral sclerosisamyotrofik lateral skleroz
ALTalanine aminotransferasealanin aminotransferaz
alt ekstremite lower extremitybacak
alternansalternansdeğişimli
alternatif tıp complementary medicine, alternative medicinetamamlayıcı tıp
altruizmaltruismözgecilik
alveolalveolus1. hava keseciği 2. diş yuvası
amaksofobiamaxophobiataşıta binme korkusu
amaroks fugaksamaurosis fugaxgeçici körlük
amastiamastiamemesizlik
amastikamasticmemesiz
amatofobiamatophobiatoz korkusu
ambivalan bağlanmaambivalent attachmentikircikli bağlanma
ambivalansambivalenceikirciklilik
AMBUartificial manual breathing unitkese-maske solutma birimi
ambulansambulancecankurtaran
ambulatuvarambulatoryayakta
AMEacute myocardial infarctionakut miyokart enfarktüsü, ivegen yürek krizi
ameliameliakolsuzluk/bacaksızlık
amenoreamenorrheaâdet görmezlik
amfiartrozamphiarthrosisyarı oynar eklem
AMIacute myocardial infarctionakut miyokart enfarktüsü, ivegen yürek krizi
amilazamylasenişastayıkan (enzim)
amiyotrofiamyotrophykas erimesi
AMLacute myeloblastic leukemiaakut miyeloblastik lösemi, ivegen miyeloblastik kan kanseri
amneziamnesiabellek yitimi
amnezi fobisiamnesiaphobiabellek yitirme korkusu
amnezik afaziamnesic aphasiaadlandırma yitimi
amniyonamniondöl kesesi
amniyosentezamniocentesisdöl kesesi suyu alımı
amorfamorphousbiçimsiz
amorfizmamorphismbiçimsizlik
amotivasyonamotivationgüdüsüzlük
amotivasyonel sendromamotivational syndromegüdüsüzlük belirgesi
AMPadenosine monophosphateadenozin monofosfat
ampirikempiricalgörgül
ampirik validiteempirical validitygörgül geçerlilik
ampiristempiristgörgülcü, deneyci
ampirizmempiricismgörgülcülük
ampiyemempyema1.akciğer zar irincesi 2.apse
amplifikatöramplifieryükselteç
amplitütamplitudegenlik
ampütasyonamputationuzuv kesimi
-an-anözgü, ait ör. ekspektoran
ANA antinuclear antibodyantinükleer antikor, çekirdek karşıtı antikor
anabolikanabolicözümleyen
anabolizananabolisingözümleyici
anabolizmaanabolismözümleme
anaerobikanaerobic1.oksijensiz 2. serbest oksijen gereksinimsiz
anaklitikanacliticduygusal bağımlılık
anaklitik depresyonanaclitic depressionduygusal bağımlılık çökkünlüğü
anakrotik anacrotic çentikli
anakrotik dalgaanacrotic waveçentikli dalga
anakrotik nabızanacrotic pulseçentikli nabız
analeptikanalepticruhsal-devinimsel uyarıcı (ilaç, madde).
analitanalyteçözümleme örneği
analitikanalytic1. çözümlemeli 2. çözümleyici
analitik psikolojianalytical psychologyçözümleyici ruh bilimi
analizanalysisçözümleme, tahlil
analjezianalgesiaağrı yitimi
analjezikanalgesicağrıkeser
analoganaloguebenzeşik
analojianalogybenzeşim, kıyas
anamnezanamnesis, case historytıbbi öykü
anastomozanastomosisağızlaştırma
anazarkaanasarcayaygın ödem
andro-andro-erkek ör. androloji
androfobiandrophobiaerkek korkusu
androitandroid1. insansı 2. erkeksi
androjenandrogenerleştirici hormon
androjenikandrogenicerleştirici
androlojiandrologyerkek üreme hastalıkları bilimi
andromimeticandromimeticerkeğe benzetici (madde)
andromimezisandromimesiserkek benzeri
andropozandropauseeril yaş dönümü
anemianemiakansızlık
anemikanemickansız
anemofobianemophobiafırtına korkusu
anensefalianencephalybeyin yokluğu
anerjianergy1. bağışıklık yanıtsızlığı 2. enerjisizlik
anestetistanesthetistanestezi uygulayıcısı
anestezianesthesiaduyusuzlaş(tır)ma
anestezi indüksiyonuanestesia inductionduyusuzlaş(tır)ma başlatımı
anestezikanestheticduyusuzlaştırıcı
anesteziyologanesthesiologistanestezi hekimi
anesteziyolojianesthesiologyanestezi bilimi
anevrizmaaneurysmbalonlaşma
anevrizmatikaneurysmaticbalonlaşmış
anevrizmektomianeurysmectomybalonlaşma çıkartımı
ANFatrial natriuretic factoratriyal natriüretik faktör, kulakçık sodyumişetir etken
anguazangoisseiç daralımı
anhedonianhedoniahaz duyumsuzluğu
anizokorianisocoriagözbebeği eşitsizliği
anjina pektorisangina pectorisgöğüs ağrısı (yürek)
anjiyo-angio-damar ör. anjiyografi
anjiyogenezangiogenesisdamarlaşma
anjiyografiangiographydamar görüntülemesi
anjiyokardiyografiangiocardiographydamar-yürek görüntülemesi
anjiyonörotik ödemangioneurotic edemadev ödem, dev şişlik
anjiyoplastiangioplastydamar onarımı
anjiyoskopiangioscopydamar göreçleme
ankilo-ankylo-1. yapışık ör. ankiloz 2. kavis, kanca ör. ankilostoma
ankiloglosiankyloglossiadil yapışıklığı
ankilostomaancylostoma kancalı kurt
ankilostoma duodenalehookworm, ankylostoma duodenalekancalı kurt
ankilozankylosisdonuk eklem
anksiyeteanxietykaygı
anksiyete bozukluklarıanxiety disorderskaygı bozuklukları
anksiyete nörozuanxiety neurosisyaygın kaygı bozukluğu
anksiyolitikanxiolytickaygıgiderir
ANNartificial neural networkyapay sinir ağı
anoftalmianophtalmiagözsüzlük
anomalianomalysapaklık
anomianomia 1.sözcük bulamama 2.değer yoksulluğu
anonişianonychiatırnaksızlık
anopsianopsiagörmezlik
anoreksianorexiaiştah kaybı, yiyesizlik
anoreksiya nervozaanorexia nervosaruhsal yemezlik
anorektikanorecticiştahkeser
anorgazmanorgasmiacinsel doyumsuzluk
anormalabnormalnormal dışı
anormal davranışabnormal behaviornormal dışı davranış
anormaliteabnormalitynormal dışılık
anormallikabnormalitynormal dışılık
anorşianorchiaerbezi yokluğu
anotanodeartı uç
anotiaanotiakulaksızlık
anovülasyonanovulationyumurtlamazlık
anozmianosmiakoku alamama
anozognozianosognosiahastalığını bilmezlik
ANPatrial natriuretic peptideatriyal natriüretik peptit, kulakçık sodyumişetir peptit
-ans-ansbelirti veya gösterge ör. alternans
anstabilunstable, labilekararsız
anstabil anjina pektorisunstable angina pectoriskararsız göğüs ağrısı (yürek)
-ant-antyapan ör. ligant
ant(i)-ant(i)-karşı, zıt ör. antasit, antibiyotik
antagonistantagonistkarşıt etkin
antagonizmantagonismkarşıt etkinlik
antasitantacidasitgiderir
ante-ante-ön, önce, öne ör. antebrakiyal
antebrakiyalantebrachialön kol (ilişkili)
antedeviyasyonantedeviationöne bükülme
antefleksiyonanteflexionöne bükülüm
antegratantegradeileriye doğru
antekübitalantecubitaldirsek içi, dirsek önü (ilişkili)
antepartumantepartumdoğum öncesi
anterioranterior1. ön 2. önde
anterior krusiyat ligamentanterior cruciate ligamentanterior çapraz bağ, diz ön çapraz bağ
anterogratanterogradeileriye doğru
anterograt amnezianterograde amnesiaileriye doğru bellek yitimi
anterograt dejenerasyonanterograde degenerationileriye doğru bozunma
anterokolisanterocollisöne eğik boyun
anterolateralanterolateralön-dışyan
anteromediyalanteromedialön-içyan
antesedanantecedenthastalık geçmişi
anteversiyonanteversionöne devrilme
antiagreganantiaggregantyığışımönler
antiaritmikantiarrhythmicdizemayarlar
antibakteriyelantibacterialbakterisavar
antidepresanantidepressantçökkünlükgiderir
antidiyabetikantidiabeticşekerdüşürür
antidiyareikantidiarrheicsürgünkeser
antidotantidoteağugiderir
antidromikantidromictersiletir
antiemetikantiemetickusmaönler
antienfektifantiinfectivebulaşkeser
antienflamatuvarantiinflammatoryyangıgiderir
antiepileptikanticonvulsivetutarıkönler
antiflojistikantiphlogisticyangıgiderir
antifungalantifungalmantarsavar
antihemofilikantihemophilickanarcaönler
antihemorajikantihemorrhagickanamadindirir
antihipertansifantihypertensivekan basınçdüşürür
antihistaminikantihistaminichistaminönler
antikoagülananticoagulantpıhtıönler
antikoagülasyonanticoagulationpıhtı önleme
antikonvülzananticonvulsanthavaleönler
antikonvülzifanticonvulsivehavaleönler
antimetabolikantimetabolicözümleme-yadımlama durdurur
antimikotikantimycoticmantarsavar
antimikrobikantimicrobicmikropsavar
antimitotikantimitoticmitozdurdurur
antineoplastikantineoplastickanser ilacı
antinükleer antikorantinuclear antibodyçekirdek antikoru
antioksidanantioxidantoksitgiderir
antiparazitikantiparasiticasalaksavar
antipedikülotikantipediculoticbitkırar
antiperspirantantiperspirantterönler
antipiretikantipyreticateşdüşürür
antiplatelet antiplateletpulyuvar yığışımönler
antiproliferatifantiproliferativeçoğalımönler
antiprüritikantipruritickaşıntıgiderir
antipsikotikantipsychoticgerçeklik yitimgiderir
antirefleantireflectiveyansıönler
antisekretuvarantisecretorysalgıönler
antisepsiantisepsismikropkırma
antiseptikantisepticmikropkırar
antisosyalantisocialtoplum karşıtı
antispazmodikantispasmodickasılımönler
antitoksikantitoxicağugiderir
antitrombotikantithromboticpıhtıönler
antitusifantitussiveöksürükkeser
antiviralantiviralvirüssavar
antraksanthraxşarbon
antropo-anthropo-insana ait ör. antropoit
antropoitanthropoidinsansı
anülerannularhalka biçimli
anüloplastiannuloplastykapak halkası onarımı
anülositannulocytehalka alyuvar
anülüsannulushalka
anürianuriaidrar yokluğu
anüsanusmakat
anyonanionnegatif yükünlü atom
anyonikanionicnegatif yükünlü
AOMacute otitis media akut otitis media, ivegen orta kulak yangısı
aort koarktasyonucoarctation of the aortaana atardamar daralımı
aort(a)aortaana atardamar
aortik valfaortic valveaort kapağı
AÖSlower esophageal sphincteralt özofageal sfinkter, yemek borusu alt büzgeni
APangina pectorisanjina pektoris, göğüs ağrısı (yürek)
apandisappendixkör ek
aparatapparatusaygıt
apatiapathykayıtsızlık
APDambulatory peritoneal dialysisayakta periton diyalizi, ayakta karın zarından arıtım
apeksapextepe
apendektomiappendectomykör ek çıkartımı
apersepsiyonapperceptionbilinçli algı
aperturaaperturegiriş ağzı
apikalapicaltepe, uç (ilişkili)
apirefobiapeirophobiasonsuzluk korkusu
apiretikapyreticateşyapmaz
apiterapiapitherapyarı ürünleriyle sağaltım
apitüitarizmapituitarismhipofiz yokluğu
aplastikaplastic gelişmemiş
aplazi aplasiagelişmezlik
aplikasyonapplicationyüzeysel uygulama
aplikatörapplicatoruygulayıcı aygıt
apneapneasoluk durması
apo-apo-1. ayıran ör. aponevroz 2.ilişkili ör. apomorfin
apodiapodia, apodyayaksızlık
apolarapolarkutupsuz
aponevrozaponeurosissert kas kılıfı
apopitozapoptosisprogramlanmış göze ölümü
apopleksiapoplexiakanagan
apprehensionapprehensionkuruntu
apraksiapraxiabeceri yitimi
aproseksiaprosexiadikkati sürdürememezlik
aprozodiaprosodytonlama bozukluğu
apseabscessirince
aPTTactivated partial thromboplastin timeaktive parsiyel tromboplastin zamanı, etkinleştirilmiş kısmi tromboplastin zamanı
ARaortic regurgitationaort regürjitasyonu, aort yetersizliği
-ar-arilişkili ör. inspiratuvar
ARAacute rheumatic feverakut romatizmal ateş, ivegen romatizmal ateş
araknodaktiliarachnodactylyörümcek parmaklılık
araknofobiarachnophobiaörümcek korkusu
araknoit arachnoidörümceksi
araknoit materarachnoid materbeyin-omurilik örümceksi zarı
araknoit zararachnoid membranebeyin-omurilik örümceksi zarı
ARB 1. angiotensin II receptor blocker 2. acid-resistant bacteria1. anjiyotensin II almacı engelleyicisi 2. aside dirençli bakteri
arborizasyonarborizationkarmaşık dallanma
ARDSacute respiratory distress syndromeakut respiratuvar distres sendromu, ivegen solunum sıkıntısı belirgesi
arefleksiareflexiatepkesizlik
areolaareolameme aylası
areolar dokuareolar tissuegözenekli bağ doku
arest arrestdurma
aritmiarrhythmiadizem bozukluğu
aritmojenikarrhythmogenicdizembozar
arkarchyay
arkuat uterusarcuate uterusyaysı dölyatağı
arkusarcusyay
arkus aortaarcus aortaana atardamar yayı
arkus senilisarcus senilis, arcus corneayaşlılık halkası
aromaaromahoş koku
artefaktartifact1. karışıntı 2. parazit
arterarteryatardamar
arteritarteritisatardamar yangısı
arteriyel switcharterial switcharteriyel değiştirim, atardamarsal değiştirim
arteriyografiarteriographyatardamar görüntülemesi
arteriyolarterioleatardamarcık
arteriyosklerozarteriosclerosisdamar sertliği
arteriyovenözarteriovenousatar-toplardamar
artifisiyelartificialyapay
artikülasyon articulation1. eklemleme, eklem 2. boğumlanma, konuşma sesi oluşturma 3.dişlerin kapanış ilişkisi
artraljiarthralgiaeklem ağrısı
artritarthritiseklem yangısı
artro-arthro-eklem ör. artroskopi
artrodezarthrodesiseklem kaynaması
artrografiarthrographyeklem görüntülemesi
artropatiarthropathyeklem sayrılığı
artroplastiarthroplastyeklem onarımı
artrorizisarthrorisiseklem devinim sınırlandırılması
artrosentezarthrocentesiseklem sıvı alımı
artroskopiarthroscopyeklem göreçleme
artrotomiarthrotomyeklem açımı
artrozarthrosiseklem kireçlenmesi
ARVDarrhythmogenic right ventricular dysplasiaaritmojenik sağ ventrikül displazisi, dizem bozan sağ karıncık yoz yapımı
AS1. aortic stenosis 2. ankylosing spondylitis1. aort stenozu, aort darlığı 2. ankilozan spondilit
ASAacetylsalicylic acidasetilsalisilik asit
asakriasacriasağrı kemiği yokluğu
ASDatrial septal defectatriyal septal defekt, kulakçıklararası açıklık
asefaliacephaliabaşsızlık
aseksüaliteasexuality1. eşeysizlik 2. cinsel kayıtsızlık
aseksüelasexual 1.eşeysiz 2. cinselliğe kayıtsız
asemptomatikasymptomaticbelirtisiz
asendanascendingçıkan, yükselen
asendan aortaascending aortaçıkan ana atardamar
asenkronasynchronyeş zamansız
asepsiasepsisbulaşsızlık (canlı dokuda mukoza, deri vb.)
aseptikasepticbulaşsız
asetabulumacetabulumdibek
asfiksiasphyxiahavasız kalma
asidozacidosiskan asitliği
asiklikacyclic1. döngüsüz 2. döngüsü düzensiz
asimetriasymmetrybakışımsızlık
asimetrikasymmetricbakışımsız
asimilasyonassimilationbenzeştirme
asinerjiasynergyeş etkimesizlik
asinöz acinous, acinar, acinosesalkımsı
asistoliasystoleyürek durması
asiyanotikacyanoticmorarmasız
asiyanotik kalp hastalığıacyanotic heart diseasemorarmasız yürek sayrılığı
askarisascarisbağırsak solucanı
ASOantistreptolysin O antistreptolizin O
asosiyasyonassociation1. çağrışım 2. ilişkilendirme
asosiyasyon korteksassociation cortexbağlantı korteksi
asosyalasocialtopluma karışamayan
asörtifassertivehakkorur
aspirasyonaspirationemerek çekme
aspiratöraspiratoremmeç
aspleniaspleniadalaksızlık
asplenikasplenicdalaksız
assitasciteskarında sıvı toplanması
ASTaspartate transaminaseaspartat transaminaz
astaziastasiaayakta duramama
asteniastheniabeden düşkünlüğü
astenikasthenicdüşkün
astenozoospermiasthenozoospermiaergöze zayıflığı
astereognoziastereognosis, tactile agnosiadokunma tanımazlığı
asteriksisasterixis, flapping tremorkanat çırpıntısı
asterniasterniagöğüs kemiği yokluğu
astigmatizmastigmatismyayıkgörü
astomiastomyağız yokluğu
astrafobiastraphobiaşimşek korkusu
astro-astro-yıldız ör. astrosit
astrositastrocyteyıldızsı göze
ASYElower respiratory tract infectionalt solunum yolu enfeksiyonu
-asyon-ationdurum ör. adaptasyon
aşağılık kompleksiinferiority complexaşağılık karmaşası
aşeliacheiliadudaksızlık
aşırı aktif mesaneoveractive bladderaşırı etkin sidik torbası
atakattack1. ani gelişen 2. nöbet
ataksiataxiasarsaklanım
ataraksiataraxiaruhsal sarsılmazlık
atelsplintdıştan kemik-eklem sabitleyici
atelektaziatelectasisakciğer büzüşmesi
ateliateliameme başı yokluğu
atenüasyonattenuationetki zayıflaması
atenüeattenuatedzayıflatılmış
aterojenezatherogenesisdamar sertliği gelişimi
aterojenikatherogenicdamar sertleştiren
aterosklerozatherosclerosisdamar sertliği
atetozathetosisyılankavi devinim
ATGantithymocytic globulinantitimositik globülin
atımpulse, pulsusvuru
-ati(v/f)-ativeeğilim tanımlayıcı. ör. konstriktif, oklüziv
atimiathymiaduygu yitimi
atipikatypicalsıra dışı
atipik depresyonatypical depressionsıra dışı çökkünlük
atipik otizmatypical autismsıra dışı otizm
atlasatlasilk omur
atlet kalbiathlete’s heartsporcu yüreği
atoniatonygerim yitimi
atopiatopyalerji yatkınlığı
ATPadenosine triphosphate adenozin trifosfat
atravmatikatraumaticörselemeyen
atreziatresiakörlenim
atrezik atresickörlenmiş
atriyalatrialkulakçık (ilişkili)
atriyal fibrilasyonatrial fibrillationkulakçık çırpıntısı
atriyal situsatrial situskulakçık konumu
atriyoventriküler atrioventricularkulakçık-karıncık (ilişkili)
atriyoventriküler disosiyasyonatrioventricular dissociationkulakçik-karıncık dizem ayrışması
atriyumatriumkulakçık
atrofiatrophykörelim
atrofikatrophickörelmiş
Atropa belladonnaAtropa belladonnagüzelavrat otu
ATTemergency medical technicanacil tıp teknisyeni
atuşmanattachment ilaç dokundurma, ıslak uygulama
auraauraöncül duyum
AV1. atrioventricular 2. arteriovenous 3. aortic valve 1. kulakçık-karıncık 2. atar-toplardamar 3. aortik valf, aort kapağı
avasküleravasculardamarsız
avasküler nekrozavascular necrosisdamarsız dokuölüm
AVBatrioventricular blockatriyoventriküler blok, kulakçık-karıncık bloku
aversiyonaversionkaçınma
avitaminozavitaminosisvitaminsizlik
aviyofobiaviophobiauçak korkusu
AVMarteriovenous malformationarteriyovenöz malformasyon, atar-toplardamar oluşum bozukluğu
AVNavascular necrosisavasküler nekroz, damarsız dokuölüm
avolisyonavolitiongüdü yitimi
AVRaortic valve replacementaortik valf replasmanı, aort kapak değişimi
awarenessawarenessfarkındalık
AYaortic insufficiencyaort yetersizliği
aybaşımenstruation, mensesâdet
-az-aseenzim ör. lipaz
azoospermiazoospermiaergözesizlik
azot protoksitnitrous oxide, laughing gasgüldürücü gaz
b.i.dtwice a day günde iki kez
BABbipolar affective disorderbipolar afektif bozukluk, iki uçlu duygu durumu bozukluğu
backscatterbackscattergeri saçılım
BAEPbrainstem auditory evoked potentialbeyin sapı işitsel evok potansiyel, beyin sapı işitsel uyarılmış gizil güç
bakterisitbactericidebakterikıran
bakteriyemibacteremiakanda bakteri
bakteriyofajbacteriophagebakteri yutar
bakteriyolojibacteriologybakteri bilimi
bakteriyostatikbacteriostaticbakteridurduran
BALbronchoalveolar lavagebronkoalveoler yıkama-örnekleme
balanitbalanitiserkeklik organ başı yangısı
balano-balano-erkeklik organ başı ör. balanit
balansbalancedenge
ballismusballismussarsılmalı devinim
balon anjiyoplastisiballoon angioplastybalonla damar açımı
balotmanballottementbıngıldama
BANbody area networkvücut alan ağları
bandajbandagesargı
bandingbandingdaraltıcı bantlama
bariyatrik cerrahibariatric surgeryşişmanlık cerrahisi
bariyerbarrierengel
baro-baro-basınç ör. baroreseptör
barorefleksbaroreflexbasınç tepkesi
baroreseptörbaroreceptorbasınç almacı
baroreseptör refleksbaroreceptor reflexbasınç almacı tepkesi
barotravmabarotraumabasınçla örselenme
basilbacillusçubuksu bakteri
başhekimchief physicianbaşsagun
BATtransposition of the greater arteriesbüyük arter transpozisyonu, büyük damarların karşılıklı yer değişimi
batınabdomenkarın
batofobibathophobiaderinlik korkusu
baypasbypassköprüleme
bazalbasal1. taban 2. temel
bazal metabolizmabasal metabolismtemel özümleme-yadımlama
bazofilbasophilmoryuvar
bazofilibasophiliamoryuvar artışı
bazofilik stiplingbasophilic stipplingmor noktalanma
bazofobibasophobiayürüme korkusu
BCG aşısıBacille Calmette-Guérine vaccineverem aşısı, Calmette-Guerin basili aşısı
BDHconnective tissue diseasebağ doku hastalıkları
beating heart surgerybeating heart surgeryatan yürekte cerrahi
beden konseptibody conceptbeden kavramı
behaviorismbehaviorismdavranışçılık
beklenti anksiyetesi anticipatory anxietybeklenti kaygısı
benignbenigniyicil
benign prostat hiperplazisibenign prostate hyperplasiaiyicil prostat irileşimi
bestiyalitezoophilia, bestiality, sodomyhayvan sevicilik
beyaz önlük fobisiwhite coat phobiabeyaz önlük korkusu
beyaz önlük hipertansiyonuwhite coat hypertensionbeyaz önlük yüksek kan basıncı
beyin herniasyonubrain herniationbeyin fıtıklaşması
bezoarbezoartopak
bi-bi-ikili, çift ör. bifazik
biasbiasyanlılık
bibliyoterapibibliotherapyokuma sağaltımı
bifazikbiphasiciki evreli
bifitbifidayrık
bifokalbifocaliki odaklı
bifürkasyonbifurcationçatallanma
bigeminebigeminyikiye bir
bigemine ritimbigeminal rhythmikiye bir dizem
bikornuat uterusbicornuate uterusiki boynuzlu dölyatağı
biküspidizasyonbicuspidizationiki yaprakçıkla(n)ma
biküspitbicuspidiki yaprakçıklı
bilateralbilateraliki taraflı
bili-bili-öd, safra ör. biliyer
bilinç sislenmesiclouding of consciousnessbilinç bulanıklığı
biliyer biliary öd, öd yolu, öd kesesi (ilişkili)
biliyer atrezibiliary atresiaöd yolu körlenimi
bimanuelbimanualiki elle
bimodalbimodaliki durumlu
binge eating bozukluğubinge eating disordertıkınma bozukluğu
binokülerbinocularçift gözle
biofeedbackbiofeedbackbiyolojik geribildirim
biomarkerbiomarkerbiyobelirteç
BiPAPbilevel positive airway pressureiki düzeyli pozitif havayolu basıncı
bipariyetal çapbiparietal diameteryanal çap
biplanbiplanariki düzlemli
bipolar bipolariki kutuplu
bipolar afektif bozuklukbipolar affective disorderiki uçlu duygu durumu bozukluğu
bipolar bozukluk Ibipolar I disorderiki uçlu duygu durumu bozukluğu I
bipolar bozukluk IIbipolar II disorderiki uçlu duygu durumu bozukluğu II
biseksüalitebisexualityçift cinsellik
bisinozisbyssinosispamuk hastalığı
bisitopenibicytopeniaçift kan göze azlığı
bistüriscalpelneşter
BiVADbiventricular assist devicebiventriküler destek cihazı, iki karıncığa destek cihazı
bivalanbivalentiki değerlikli
biyoenformatikbioinformaticsbiyobilişim
biyogüvenlik kabinibiosafety cabinetsüzer çekerocak
biyokompatibilitebiocompatibilitydirim geçimliliği
biyolojibiologyyaşam bilimi
biyolojikbiologicalyaşam (ilişkili)
biyolojik ritimbiological rhythmyaşamsal dizem
biyomikroskopbiomicroscopecanlıda minigözler
biyopsibiopsyparça alımı
biyopsikososyal modelbiopsychosocial modelbiyopsikososyal yaklaşım
bizar delüzyonbizarre delusionsaçma sanrı
BKİbody mass indexbeden kütle indeksi, beden kütle göstergesi
-blast-blastöncül, genç hücre, göze ör. lenfoblast
blasto-blasto-erken oluşum ör. blastomer
blastomerblastomereöndölüt gözesi
blastosistblastocystöndölüt kesesi
blefaritblepharitisgöz kapak yangısı
blefaro-blepharo-göz kapağı ör. blefarospazm
blefarospazmblepharospasmgöz kapak kasılımı
blok,-ublock1. engel 2. yürek bloku
blokajblockadeengelleme, durdurma
blokerblockerengelleyici
BMIbody mass indexvücut kütle indeksi, beden kütle göstergesi
BMSbare metal stentçıplak metal kafesçik
BNbatch numberparti numarası
BNPbrain natriuretic peptide, B-type natriuretic peptidebeyin natriüretik peptit, beyin sodyumişetir peptit
board sınavıboard examinationyeterlik sınavı
bolusbolusbol veriş
bonebonnetbaşlık
booster aşıbooster shotpekiştirme aşısı
booster dozbooster dosepekiştirme dozu
borderline kişilik bozukluğuborderline personal disordersınırda kişilik bozukluğu
borderline zekâborderline intelligencesınırda zekâ
BOScerebrospinal fluidbeyin-omurilik sıvısı
botoksbotulinum toxin, botoxbotulinum ağusu
böbrek pelvisirenal pelvisböbrek havuzcuğu
böcek repellentinsect repellentsböcek uzaklaştırıcı
BÖHinfant mortality ratebebek ölüm hızı
BPblood pressurekan basıncı
BPHbenign prostatic hyperplasiabenign prostat hiperplazisi, iyicil prostat irileşimi
bpmbeat per minutedakika vuru sayısı
bradi-brady-yavaş ör. bradikardi
bradifazibradyphasiayavaş konuşma
bradifrenibradyphreniayavaş düşünme
bradikardibradycardiayavaş vuru
bradikinezibradykinesiayavaş devinim
bradilalibradylaliayavaş konuşma
bradileksibradylexiayavaş okuma
bradipne bradypneayavaş solunum
braki-1. brachi- 2. brachy-1. kol ör.brakiyal sinir 2. kısa ör. brakisefali
brakidaktilibrachydactylykısa parmaklılık
brakignatibrachygnathiakısa çenelilik
brakisefalibrachycephalybasık kafalılık
brakisefalikbrachycephalicbasık kafalı
brakisindaktilibrachysyndactyly yapışık kısa parmaklılık
brakiterapibrachytherapyyakın ışın sağaltımı
brakiyalbrachialkol (ilişkili)
branchingbranchingdallanma
branşbranchdal
breath-holding spellbreath-holding spellkatılma nöbeti, uğunmak
bregmabregmabaş ön tepesi
britbrideyapışıklık
Broca afazisiBroca aphasiadevinimsel lisan yitimi, motor afazi
bronkodilatasyonbronchodilatationsoluk borusu genişlemesi
bronkodilatörbronchodilatorsoluk borusu genişleten
bronkografibronchographysoluk borusu görüntülemesi
bronkokonstriksiyonbronchoconstrictionsoluk borusu daralması
bronkokonstriktörbronchoconstrictorsoluk borusu daraltan
bronkopulmoner displazibronchopulmonary dysplasiaakciğer yoz gelişimi
bronkoskopbronchoscopesoluk borusu göreci
bronkoskopibronchoscopysoluk borusu göreçleme
bronşbronchussoluk borusu
bronş(ko)-broncho-soluk borusu ör. bronşektazi
bronşektazibronchiectasiasoluk borusu genişlemesi
bronşiyalbronchialsoluk borusu (ilişkili)
bronşiyolbronchiole, bronchiolussoluk borucuğu
brontofobibrontophobiagök gürültüsü korkusu
bruksizmbruxismdiş gıcırdatma
brusellozbrucellosispeynir hastalığı, Malta humması, Akdeniz ateşi
BTcomputerized tomography, computed tomographybilgisayarlı tomografi, bilgisayarlı kesitçekim
BTSBlalock-Taussig shuntBlalock-Taussig şant
buftalmusbuphthalmusöküzgözü
bukkabuccaavurt
bukkal smirbuccal smearavurt yayması, yanak mukoza yayması
bukko-bucco-yanak ör. bukkolabiyal
bukkolabiyalbuccolabialyanak-dudak (ilişkili)
bulbus1. medulla oblongata 2. bulbus1. soğanilik, omurilik soğanı 2. küresel veya iğimsi
bulimibulimiatıkınıp çıkarma
bulimikbulimictıkınırçıkarır
bulimiya nervozabulimia nervosatıkınçıkar bozukluğu
BUNblood urea nitrogenkan üre azotu
bundle branch blockbundle branch blockdal bloku
burn-outburn-outtükenmişlik
bursabursayastıkçık
bülbullasıvılı kabarcık
Ccomplementkompleman
Ca1. cancer 2.calcium 1. kanser 2. kalsiyum
CABGcoronary artery bypass graftingkoroner arter baypas greftlemesi, taç atardamar köprülemesi
CAD 1. coronary artery disease 2. computer aided design1. koroner arter hastalığı, taç atardamar hastalığı 2. bilgisayar destekli tasarım
café au lait lekesicafe au lait spotsütlü kahve lekesi
calvaria calvariakafatası kubbesi
CAMcomputer aided manufacturingbilgisayar destekli üretim
canlı donörlive donorcanlı verici
CAPcommunity acquired pneumoniatoplum kökenli akciğer yangısı
caput headbaş
cardioverter-defibrillatorcardioverter-defibrillatordizemdüzeltir
CAVcardiac allograft vasculopathykardiyak allograft vaskülopati,yürek türdeş yama damar sayrılığı
CBCcomplete blood counttam kan sayımı
CBCTcone beam computerized tomographykoni ışınlı bilgisayarlı tomografi
CBFcerebral blood flowserebral kan akımı, beyin kan akımı
CCSchronic coronary syndromekronik koroner sendrom, süregen taçdamar belirgesi
CCTAcoronary computed tomographyangiograhykoroner bilgisayarlı tomografi anjiografi, taçdamar bilgisayarlı kesitçekim damar görüntülemesi
CCUcoronary intensive care unitkoroner yoğun bakım birimi
CDCCenter for Disease ControlAmerika Hastalık Kontrol Merkezî
cerahatpusirin
cerrahi drillsurgical drillcerrahi matkap
cerrahi eksplorasyonsurgical explorationcerrahi açbak
cerrahi maskesurgical maskağız-burun koruyucu kullanat kumaş
cerrahi operasyonsurgical operationameliyat
ceza ehliyeticriminal responsibilityceza sorumluluğu
CFcystic fibrosiskistik fibröz
CHD1. congenital heart disease 2. coronary heart disease1. konjenital kalp hastalığı, doğuştan yürek sayrılığı 2. koroner kalp hastalığı, taçdamar yürek sayrılığı
checklist checklist kontrol listesi
child-proof kapakchild-proof containerçocukaçamaz kapak
CI1. cardiac index 2. confidence interval1. yürek indeksi 2. güven aralığı
CIEDcardiovascular implantable electronic deviceyürek-damar içi elektronik aygıt
CIS carcinoma in situin situ kanser, yerinde kanser
cihazdeviceaygıt
cinsiyet disforisigender dysphoriacinsiyetinden yakınma
cinsiyet kromozomusex chromosomeeşey kromozomu
CK creatine kinasekreatin kinaz
CK-MBcreatine kinase myocardial bandkreatin kinaz miyokardiyal bant, kreatin kinaz yürek kas bandı
clubbingclubbing, clubbed finger drumstick fingerçomak parmak
clubfootclubfootçarpık ayak
clubhandclubhandçarpık el
CMRcardiac magnetic resonancekardiyak manyetik rezonans
CMRO2cerebral metabolic rate of oxygenbeyin oksijen tüketiminin metabolik oranı
CMVcytomegalovirussitomegalovirüs
CNScentral nervous systemmerkezî sinir sistemi
CO1. cardiac output 2. carbonmonoxide1. kardiyak output, yürek debisi 2. karbonmonoksit
CoA coenzyme Akoenzim A
coldpackcoldpacksoğuk paket
con(m)-con(m)-birlikte ör. kombinasyon, konjüge
conduct disorderconduct disorderdavranım bozukluğu
COPDchronic obstructive pulmonary diseasekronik obstrüktif akciğer hastalığı, süregen tıkayıcı akciğer sayrılığı
cor heartyürek
cor bovinum cor bovinumöküz yüreği
corona viruscorona viruskoronavirüs
Corrigan nabızCorrigan pulsesıçrayıcı vuru
CPcerebral palsyserebral palsi, beyin felci
CPAPcontinuous positive airway pressuresürekli pozitif havayolu basıncı
CPBcardiopulmonary bypasskardiyopulmoner baypas, yürek-akciğer köprülemesi
CPETcardiopulmonary exercise testkardiyopulmoner egzersiz testi, yürek-akciğer alıştırma testi
CPPcerebral perfusion pressureserebral perfüzyon basıncı, beyin kanlanma basıncı
CPRcardiopulmonary resuscitationkardiyopulmoner resüsitasyon, yürek-akciğer canlandırması
CrClcreatine clearancekreatin temizlenmesi
CRFchronic renal failurekronik renal yetmezlik, süregen böbrek yetmezliği
cristacrest1. ibik 2. tepe 3. sırt 4. tırtıklı kenar
cross-matchingcross-matchingçapraz karşılaştırım
cross-overcross-overçaprazlanma
cross-over çalışmacross-over studyçapraz karşılaştırmalı araştırma
cross-sectional çalışmacross-sectional studykesitsel çalışma
CRPC-reactive proteinC-reaktif protein
CRT1.cardiac resynchronization therapy 2. capillary refill time1.kardiyak resenkronizasyon terapisi, yürek eş zamanlama sağaltımı 2. kılcal damar dolum zamanı
crush sendromucrush syndromeezilme belirgesi
CScardiogenic shockkardiyojenik şok, yürek kaynaklı şok
CSFcerebrospinal fluidserebrospinal sıvı, beyin omurilik sıvısı
CTcomputerized tomography, computed tomographybilgisayarlı tomografi, bilgisayarlı kesitçekim
CTEPHchronic thromboembolic pulmonary arterial hypertensionkronik tromboembolik pulmoner arter hipertansiyonu, süregen pıhtı tıkanır akciğer damar yüksek basıncı
CTOchronic total occlusionkronik total oklüzyon , ivegen tam tıkanıklık
cul de saccul de sac kör kese
cut-off değericut-off valuekesim değeri
CV1.cardiovascular 2. curriculum vitae1.kardiyovasküler, yürek-damar 2. özgeçmiş
CVAcerebrovascular accidentserebrovasküler aksedan, beyin-damar olayı
CVPcentral venous pressuresantral venöz basınç, merkezî toplardamar basıncı
cyberknifecyberknifeışın bıçağı
cycl(o)-cycl(o)-döngüsel
çalışma belleğiworking memoryişlerbellek
çalma fenomenisteal phenomenonçalma görüngüsü
çapraz toleranscross toleranceçapraz alışma
çekapcheck-uptam bakım
çeklistchecklistkontrol listesi
çekumcecumkörbağırsak
çengelli kurthookwormkancalı kurt
çerofobicherophobiaeğlenme korkusu
ÇLEBTdouble lumen endobronchial tubeçift lümenli endobronşiyal tüp
çocuk istismarıchild abuseçocuk sömürüsü
çocuk ve ergen psikiyatrisichild and adolescent psychiatryçocuk ve ergen ruh hekimliği
ÇOİBBmultiorgan dysfunction syndromeçoklu organ işlev bozukluğu belirgesi
ÇOYmultiorgan failureçoklu organ yetmezliği
çölyo-celio- karın (ilişkili) ör. çölyak atardamar
DAdopaminedopamin
dakri(yo)-dacry(o)-gözyaşı ör. dakriyosistit
dakriyoitdacryoidgözyaşını andıran
dakriyolitdacryolithgözyaşı kanal taşı
dakriyomenoredacryohemorrheakanlı gözyaşı
dakriyondacryongözyaşı köşesi
dakriyopsdacryops1. gözyaşı kanal kisti 2. aşırı gözyaşı
dakriyosist dacryocystgözyaşı kesesi
dakriyosistitdacryocystitisgözyaşı kesesi yangısı
daktil-dactyl-parmak ör. daktilo
daktilitdactylitisparmak yangısı
daktilojiropozisdactylogryposisel parmak büzülükalım
daktilolizisdactylolysis1.parmak kaybı 2.yapışık parmak onarımı
daktilomegalidactylomegalyparmak büyüklüğü
daktilondactylionperde parmaklılık
daktiloskopidactyloscopyparmak izi inceleme
daktilospazmdactylospasmparmak kasılımı
daktriyositdacryocyte, teardrop cellgözyaşı alyuvar
DALEDisability Adjusted Life Expectancyyeti yitimine ayarlanmış yaşam beklentisi
DALYDisability Adjusted Life Yearsyeti yitimine ayarlanmış yaşam yılları
damla kalpteardrop heartdamla yürek
damping sendromudumping syndromemide boşalım belirgesi
dansitedensity1. yoğunluk 2. özgül ağırlık
dansitometredensitometeryoğunlukölçer
dansitometridensitometry1. yoğunluk ölçümü (sıvı) 2. gölge yoğunluk ölçümü
datadataveriler
databasedatabaseveri tabanı
davranışçı terapibehavioral therapydavranışçı sağaltım
davranışsal inhibisyonbehavioral inhibitiondavranışsal baskılanma
davranış modifikasyonubehavior modificationdavranış biçimlendirme
davranışsal aktivasyonbehavioral activationdavranışsal etkinleştirme
daydreamdaydreamgündüz düşü, düşleme
DBSdeep brain stimulationderin beyin stimülasyonu, derin beyin uyarımı
DBUdeep brain stimulationderin beyin stimülasyonu, derin beyin uyarımı
DCMdilated cardiomyopathydilate kardiyomiyopati, genişlemiş yürek kas sayrılığı
de-de-1.azalma ör. demiyelinizasyon 2. uzaklaşma ör. denervasyon 3. tersini uygulama ör. defibrilasyon, dekompresyon 4. olumsuzlama ör. deformasyon, dejenerasyon
de factode factogerçekte, uygulamada
de novode novoyeniden
de(z)-de(s)-ayırma, ayrıştırma
debilitedebilityhafif zekâ geriliği
debranchingdebranchingdal ayırma
debridmandebridementayrıtlama
debrisdebris1. yıkıntı 2. ölü doku
debulkingdebulking1. kütle küçültme 2. hacim küçültme
dedeksiyondetectionaramabulma
dedektördetectorararbulur
defans mekanizmalarıdefence mechanismssavunma düzenekleri
defekasyondefecationdışkılama
defektdefectkusur
defektifdefectivekusurlu
defeminizasyondefeminizationdişiliksizleşme
deferensdeferensgötürgen
defeyansdefeasancebayınma
defibrilasyondefibrillationçırpıntı durdurumu
defibrilatördefibrillatorçırpıntıdurdurur
defibrinasyon defibrinationfibrinsizleşme
defisitdeficiteksiklik
defleksiyondeflectionsapış
deflorasyondeflorationkızlık zarı yırtılması
deformasyondeformationbiçimsizleşme
deformitedeformitybiçim bozukluğu
degradasyondegradation1. bozunma 2. yıkılım
dehidratasyondehydrationsu-yükün yitimi
dehisansdehiscencedoku ayrılım
déjà entendudéjà entendusanki işittim sanısı
déjà pensédéjà pensésanki düşündüm sanısı
dejavüdéjà vusanki gördüm sanısı
dejenerasyondegenerationbozunma
dejeneratifdegenerativebozunduran
dekalsifikasyondecalcificationkireçsizleşme
dekanülasyondecanulationborucuk çıkartımı
dekapitasyondecapitationbaşsızlaştırma
dekapsülasyondecapsulationkapsül çıkartımı
dekatdecadeonyıl
deklaratif bellekdeclarative memorybildirimsel bellek
dekolmandetachmentdoku ayrılması
dekompansedecompensated1.dengelenememiş 2.dağılmış
dekompanzasyondecompensation1.dengelenememe 2.dağılma
dekompresyondecompressionbası giderme
dekompresyon hastalığıdecompression sicknessvurgun
dekonjestandecongestantşişgiderir
dekonjestiyondecongestiongöllenme giderimi
dekontaminasyondecontaminationarıklaştırma
dekortikasyondecorticationkabuksuzlaştırma
dekreşendodecrescendogiderek azalan
deksterdextersağ
dekstorotasyondextrorotationsağa dönüş
dekstro-dextro-sağ, sağda ör. dekstrokardi
dekstrokardidextrocardiasağda yürek
dekusasyondecussationçaprazlama
dekübitusdecubitusyatarkonum
dekübitus anjinasıangina decubitus yatarkonum göğüs ağrısı
dekübitus ülseridecubitus ulcerbası yarası
dekübitus yarasıdecubitus ulcerbası yarası
deliryumdeliriumdelirgenlik
deliryum tremensdelirium tremensalkol kesilmesi delirgenliği
deltoitdeltoidüçgenimsi
delüzyondelusionsanrı
delüzyonel algıdelusional perceptionsanrısal algı
delüzyonel bozuklukdelusional disordersanrısal bozukluk
delüzyonel sezgidelusional intuitionsanrısal sezgi
demansdementiabunama
demarkasyondemarcationayrım çizgisi
demineralizasyondemineralizationmineralsizleşme
demiyelinizasyondemyelinizationmiyelinsizleş(tir)me
demofobidemophobiakalabalık korkusu
demografidemographynüfus bilimi
demografikdemographicnüfus bilimsel
demonstrasyondemonstrationtanıtım gösterisi
denatürasyondenaturationdoğal yapının bozulması, denşirme
denatüredenaturateddoğal yapısı bozulmuş
denervasyondenervationsinirsizleşme
denitrojenizasyondenitrogenizationnitrojensizleştirme
dentaldentaldiş
dentatdentatedişsi
dentisyondentition dişlenme
dentritdentritsinir göze saçağı
deodorandeodorant kokuönler
deontolojideontologymeslek ahlakı bilimi
departmandepartment1.anabilim dalı 2.bölüm 3.daire
depersonalizasyondepersonalizationkendine yabancılaşma
depilasyondepilationkılsızlaştırma
depilatuvardepilatorykıldöker
deplasmandisplacementyer değiştirme
deplesyondepletion1.tükenme 2.silinme
deplümasyondeplumationkirpik dökülmesi
depolarizasyondepolarizationkutupsuzlaşma
depresördepressoraşağıçeken
depresyondepression1. çökkünlük 2. çökme
derailmentderailmentraydan çıkma
derealizasyonderealization gerçek dışılama
dereistik düşüncedereistic thinkinggerçek dışı düşünme
deri apsesiskin abscessçıban
deri layşmanyazıcutaneous leishmaniasisşark çıbanı
derivasyonderivation1. elektrik gerilim farkı 2.türetme
derivatifderivativetüremiş
derivederivedtüremiş
dermderm1. deri 2. katman 3. yaprak
derm(o)-derm-deri, deri ör. dermatoloji
dermabrazyondermabrasionderi aşındırma
dermatitdermatitisderi yangısı
dermatologdermatologistderi ve zührevi hastalıklar uzmanı
dermatolojidermatologyderi hastalıkları bilimi
dermatomdermatome1. deri duyu kuşağı 2. derisıyıran (aygıt)
dermis dermis alt deri katmanı
DESdrug-eluting stentilaçsalar stent, ilaçsalar kafesçik
desandandescendinginen
desandan aortadescending aortainen ana atardamar
desatüredesaturedoymamış
deselerasyon decelerationyavaşlama
desensitizasyondesensitizationduyarsızlaştırma
desiduadeciduagebelik dölyatağı zarı
deskriptif araştırmadescriptive researchbetimsel araştırma
deskuamasyondesquamationdökülme
destinasyon terapisidestination therapy1. soncul sağaltım 2. yolculuk sağaltımı
destrüksiyondestructionyıkım
destrüktifdestructiveyıkıcı
deşarjdischargeboşalım
detaşmandetachmentayrılma
detaydetailayrıntı
determinandeterminantbelirleyici
determinasyondeterminationbelirleme
determinizmdeterminismbelirleyimcilik
detoksifikasyondetoxificationağusuzlaştırma, arındırma
detorsiyondetorsionburulum açma
detrüsördetrusormesane kası
devalüasyondevaluationdeğersizleştirme
devitalizasyondevitalisationcansızlaştırma
deviyasyondeviationsapma
dexterrightsağ (yön)
dezartikülasyondisarticulation1.eklemden ayırma 2. eklemleyememe
dezenfeksiyondisinfectionbulaş savma
dezenfektandisinfectantbulaşsavar
dezentegrasyondisintegration1. parçalanma 2. benlik dağılma
dezorganize düşünmedisorganized thinkingdarmadağın düşünme
dezoryantasyondisorientationyönelim bozukluğu
DGdirect radiographydirekt grafi, doğrudan X-ışınlı görüntüleme
DIdiabetes insipidusdiabetes insipidus, şekersiz şeker hastalığı
DICdisseminated intravascular coagulationdisemine intravasküler koagülasyon, yaygın damar içi pıhtılaşma
DICOMdigital imaging and communications in medicinetıpta sayısal görüntüleme ve iletişim
di-di-iki ör. dipleji
diabetes insipidus diabetes insipidusşekersiz şeker hastalığı
diabetes mellitusdiabetes mellitusşeker hastalığı
diaper dermatitidiaper dermatitisalt bezi dermatiti
diartrozdiarthrosisoynar, hareketli (eklem)
didelfikdidelphicçift dölyataklı
didelfisdidelphysçift dölyatağı
diensefalondiencephalonarabeyin
difazikdiphasiciki evreli
diferansiyasyondifferentiationfarklılaşma
diferansiyedifferentiatedfarklılaşmış
diferansiyel diyagnozdifferential diagnosisayırıcı tanı
difteridiphtheriakuşpalazı
difüzdiffuseyaygın
difüzyondiffusiongeçişme
digitalis purpureaDigitalis purpureayüksük out
dijestandigestantsindirim kolaylaştıran
dijestifdigestivesindirim kolaylaştırır
dijit-digit-parmak ör. dijital
dijitaldigital1.sayısal 2.parmakla 3. parmaksı
dijitalizasyondigitalization1.       dijitalleme 2.sayısallaştırma
dijiti minimidigiti minimiserçe parmak
DİKdisseminated intravascular coagulationdisemine intravasküler koagülasyon, yaygın damar içi pıhtılaşma
dikkat eksikliği hiperaktivite bozukluğuattention deficit hyperactivity disorderdikkat eksikliği aşırı devinim bozukluğu
dikrotikdicroticçift vurulu
dilatasyondilatationgenişleme
dilatedilatedgenişlemiş
dilate kardiyomiyopatidilated cardiomyopathygenişlemiş yürek kas sayrılığı
dilatördilatorygenişleten
diluedilutedseyreltik
dilüsyondilutionseyreltme
-dinami-dynamiaenerji, eylem veya işlev ör. ürodinami
dinamikdynamicdevingen
dinamik psikolojidynamic psychologydinamik ruh bilimi
dinamometredynamometergüçölçer
-dini-dyniaağrı ör. koksiksodini
diplejidiplegiaiki taraflı felç
diplopidiplopiaçift görme
dipolardipolariki kutuplu
dipsomanidipsomaniaiçme saplantısı
direksiyoneldirectionalyönlendirilmiş
direktdirectdoğrudan
dis-dis-ayrı, ayırma ör. diseksiyon, disosiyasyon, disekulibriyum
dis(z)-dys-kötü, zor ör. displazi, disfaji, dizartri
disabilitedisability1. engellilik 2. yeti yitimi
disdiyadokinezidysdiadochokinesiaardışık devinim bozukluğu
disekilibriumdysequilibriumdengesizleşme
diseksiyondissection1. kesayır 2. kendiliğinden ayırılma ör aort diseksiyonu
disektördissectorayırgaç
diseminasyondisseminationyayılma
disemine intravasküler koagülasyondisseminated intravascular coagulationyaygın damar içi pıhtılaşma
disfajidysphagiayutma güçlüğü
disfazidysphasiasöz dizimsel konuşma bozukluğu
disfonidysphoniases bozukluğu
disfonksiyondysfunctionişlev bozukluğu
disforidysphoriabungunluk
disforikdysphoricbungun
disgenezidysgenesisyoz gelişim
disgrafidysgraphiayazı-çizi bozukluğu
disguzidysgeusiatat alma bozukluğu
diskdiscyuvarlak ve yassı (oluşum, yapı). ör. diskopati
disk hernisidiscal herniaomurlararası eklem fıtığı
diskalkülidyscalculiahesaplama bozukluğu
diskinezidyskinesiadevinim bozukluğu
diskoneksiyondisconnectionbağlantı kesilmesi
diskopatidiscopathyomurlararası eklem sayrılığı
diskordandiscordantuyumsuz
diskordansdiscordanceuyumsuzluk
diskriminandiscriminantayırt edici
dislalidyslaliakonuşma güçlüğü
disleksidyslexiaokuma bozukluğu
dislokasyondislocationçıkık
dismenore dysmenorrheaağrılı âdet
dismetridysmetriauzaklık kestirimsizliği
dismorfikdismorphicbozuk biçimli
dismorfofobidysmorphophobiabiçim bozukluğu korkusu
dismorfolojidysmorphologybiçim bozukluğu bilimi
disomnidysomniauyku bozukluğu
disorderdisorderbozukluk
disosiyasyondissociation1. ayrışma 2. ruhsal çözülme
disosiyatif amnezidissociative amnesiaruhsal çözülüm bellek yitimi
disosiyatif bozuklukdissociative disorderruhsal çözülüm bozukluğu
disosiyatif derealizasyondissociative derealization kendine yabancılaşma çözülmesi
disosiyatif fügdissociative fugueruhsal çözülüm kaçışı
disosiyatif kimlik bozukluğudissociative identity disorderkimlik çözülmesi bozukluğu
disozmidysosmiakoku alma bozukluğu
disparönidyspareuniaağrılı cinsel ilişki (kadında)
dispepsidyspepsiahazımsızlık
dispersiyondispersionsaçılım
displazidysplasiayoz yapım
displazik dysplasticyozlaşık
dispnedyspneasoluk darlığı
dispozıbıldisposablekullanat, tek kullanımlık
dispraksidyspraxiadevinimsel beceri bozukluğu
disproporsiyondisproportionorantısızlık
disprosodidysprosodiasöz ezgisi bozukluğu
disrafidisraphybitişim bozukluğu
disritmidysrhythmiadizem bozukluğu
distaldistalbaşlangıca uzak
distansiyondistension1.gerginlik 2.şişkinlik
distilasyondistillationdamıtma
distiledistilleddamıtık
distimik bozuklukdysthymic disordersüregen mutsuzluk bozukluğu
distonidystoniagerim bozukluğu
distorsiyondistortion1. gerçeği saptırma 2. burkulma
distosidystociazor doğum
distraksiyondistractiondikkat çelinmesi
distraktibilitedistractibilitydikkat çelinirliği
distresdistress1. sıkıntı 2. zorlanma
distribüsyondistributiondağılım
distribütördistributordağıtımcı
distrofidystrophyyozlaşım
dişci fobisidentist phobiadiş hekimi korkusu
diüretikdiureticidrarsöker
diürezdiuresisidrar sökümü
diürnaldiurnalgünboyu
divalandivalentiki değerlikli
diverjansdivergence1.ıraksama, 2.ayrıklaşma
divertiküldiverticulum, diverticulacepçik
diya-dia-arasında ör. diyafram, diyafiz, diyastol
diyabetdiabetes mellitusşeker hastalığı
diyabetikdiabetic1. şeker hastası 2. şeker hastalığı (ilişkili)
diyabetojenikdiabetogenicşeker hastalığı yapan
diyadokinezidiadochokinesisardışık devinim
diyafiz diaphysisanagövde
diyaforezdiaphoresisterleme
diyaframdiaphragma böleç
diyafram hernisidiaphragmatic herniaböleç fıtığı
diyagnostikdiagnostictanısal
diyagnozdiagnosistanı
diyagonaldiagonalköşegen
diyagramdiagramçizge
diyalizdialysisarıtım
diyalizatdialysatarıtım sıvısı
diyapazondiapasonetitreşim çatalı
diyarediarrheaishal
diyastazdiastasis1. yavaş doluş 2. ayrılım
diyastematomiyelidiastematomyeliaomurilik yarılması
diyastoldiastoleyürek kas gevşemesi
diyastolik kan basıncıdiastolic blood pressuregevşem kan basıncı
diyatermidiathermyısı uygulaması
diyatezdiathesisdoğal yatkınlık
diyetdietbeslenme düzeni
diyetetikdieteticsbeslenme bilgisi
diyetisyendieticianbeslenme uzmanı
diyoptridioptrymercek ışık kırımı
dizanteridysenterykanlı ishal
dizartridysarthriadevinimsel konuşma bozukluğu
dizayndesigntasarım
dizigotikdizygoticikicil döllenimli, çift yumurta
dizüridysuriazor ve ağrılı işeme
DKH1. congenital heart disease 2. decompression sickness1. doğuştan kalp hastalığı, doğuştan yürek sayrılığı 2. dekompresyon hastalığı, vurgun
DLdeep learningderin öğrenme
DMdiabetes mellitus diabetes mellitus, şeker hastalığı
DMAHlow-molecular weight heparindüşük molekül ağırlıklı heparin
DMSOdimethyl sulphoxydedimetilsülfoksit
DNAdeoxyribonucleic aciddeoksiribonükleik asit
DNA mismatch repairmismatch repairDNA yanlış eşleşme onarımı
DNNdeep neural networkderin sinir ağı
doğum indüksiyonulabor inductiondoğumu uyartımı
doktordoctorsagun
doliko-dolicho-uzun ör. dolikosefali
dolikosefalidolichocephalyuzun kafalılık
dolikosefalikdolichocephalicuzun kafalı
dolordolor, painağrı
dolorojenikdolorogenicağrıtıcı
domdomekubbe
dominansdominancebaskınlık
dominantdominantbaskın
dominant davranışdominant behaviorbaskın davranış
dominant foliküldominant folliculebaskın folikül
domingdomingkubbeleşme
donasyondonation1. bağış 2. bağışlama
donördonorverici
dopadihydroxyphenylalaninedihidroksifenilalanin
dorsaldorsalsırt (ilişkili)
dorsifleksiyondorsiflexionekstansiyon (el veya ayak bileği) geriye bükme
dorso-dorso-sırt ör. dorsolomber
dorsolomberdorsolumbarsırt-bel
dorsumdorsumsırt
double bubbledouble bubbleçift köpük
double cortexdouble cortexçift korteks
double-blinddouble-blindçift-kör
downregulationdownregulationazalarak düzenlenim
downstreamdownstreamaşağı akış
dozajdosagedozlama
dozimetredosimeterışınölçer
drajecoated tabletcilalı tablet
dren drainakıtaç
drenaj drainageakaçlama
dreypdrapecerrahi deri örtüsü
drilldrilldelgi, matkap
dromofobidromophobiahareket etme korkusu
dromomanidromomaniakoşma saplantısı
dromotropikdromotropiciletimetkiler
dry tapdry tapkuru ilik
DSA1. donor specific antigen1. verici özgül antijen 2. dijital subtraksiyon anjiyografi, sayısal çıkarımlı damar görüntülemesi
2. digital subtraction angiography
DSÖWorld Health OrganizationDünya Sağlık Örgütü
DTdelirium tremensdeliryum tremens
DTRdeep tendon reflexderin tendon refleksi, derin kiriş tepkesi
dualdualikili
dubledoubleçift
duktoskopductoscopememe kanal göreci
duktoskopiductoscopymeme kanalı göreçleme
duktusductuskanal ör. duktus arteriyozus açıklığı
duodenoskopduodenoscopeonikiparmak bağırsak göreci
duodenoskopiduodenoscopyonikiparmak bağırsak göreçleme
duodenumduodenumonikiparmak bağırsağı
duplikasyonduplicationikileşme
dura materdura materbeyin-omurilik sert zarı
durabilitedurabilitydayanıklılık, sağlamlık
durumluk anksiyetestate anxietydurumluk kaygı
duygu durumu labilitesimood labilityduygu durumu değişkenliği
düşünce blokuthought blockdüşünce durması
düşünce fakirliğipoverty of thought düşünce yoksulluğu
DVTdeep vein thrombosisderin ven trombozu, derin toplardamar pıhtısı
dwarfismdwarfismcücelik
DYB lateral collateral ligamentlateral koleteral bağ, diz dış yan bağ
DYHcongenital heart diseasedoğuştan yürek hastalığı
EBUSendobronchial ultrasonographyendobronşiyal ultrasonografi, soluk borusundan sesötesi göreçleme
EBVEbstein-Barr virusEbstein-Barr virüsü
EC50 effective concentration of 50%etkili yoğunluğun % 50’si
ECA external carotid arteryeksternal karotis arter, dış şahdamar
ECC extracorporeal circulationekstrakorporal sirkülasyon, beden dışı dolaşım
écho de la penséethought echodüşünce yankılanması
ECMO extracorporeal membrane oxygenationekstrakorporal membran oksijenlenme, beden dışı oksijenlenme
ED50 effective dose 50etkili dozun yarısı
EDGF endothelial-derived growth factorendotel türevli büyüme etkeni
EDHepidural hematomaepidural hematom, beyin-omurilik sert zarı üstü kan toplağı
EDRFendothelium-derived relaxing factorendotel türevli gevşeme etkeni
EDTAethylenediamine tetraacetic acidetilendiamin tetraasetik asit
EEinfective endocarditisenfektif endokardit
EEGelectroencephalogramelektroensefalogram, beyin elektrik çizgesi
EFejection fractionejeksiyon fraksiyonu, fırlatma yüzdesi
efasmaneffacementdölyataği boyun silikleşmesi
efektif effectiveetkili
eferentefferentgötürgen
efervesan effervescentfışırdayan
efikasiefficacyetkililik
efor dispnesiexertional dyspneaeforda soluk darlığı
efüzyoneffusionzarlar arası sıvı toplanması
ego egobenlik
ego gücüego strengthbenlik gücü
ego içgüdüsüego instinctbenlik içgüdüsü
ego savunmasıego defencebenlik savunması
egodistonikegodystonicbenlik uyumsuz
egofoniegophonykeçi sesi
egoistegoistbencil
egosantrikegocentricbenmerkezli
egosintonikegosyntonicbenlik uyumlu
egz-exo-dış ör. egzojen, egzoftalmi
egzamaeczemabulaşıcı olmayan deri yangısı
egzantemexanthemakızarık deri döküntüsü
egzersiz exercisealıştırma
egzistansiyalizm existentialismvaroluşçuluk
egzoforiexophoriagizli dışa şaşılık
egzoftalmi exophthalmosbörtlek göz
egzojenexogenousdış kaynaklı
egzokrin exocrinedış salgı
egzositoz exocytosisgöze dışı atım
egzoterik exotericdışsal
egzotoksinexotoxindışağu
egzotropiexotropydışa şaşılık
e-hastae-patientelektronik bilgilenmiş hasta
ejakülasyonejaculationersuyu atımı
ejakülatejaculateatmık
ejakülatuvar kanal ejaculatory ductatmık kanalı
ejeksiyon ejectionfırlatma
ejeksiyon fraksiyonu ejection fractionfırlatma yüzdesi
EKAexternal carotid arteryeksternal karotis arter, dış şahdamar
ekartasyonretractionçekayır
ekarte etme1. rule out 2. retraction1. dışlama 2. çekayır
ekartörretractorayırgaç
EKGelectrocardiogramelektrokardiyogram, yürek elektrik çizgesi
eki-equi-eşit ör. ekilibriyum
ekilibriyumequilibriumeşitlenme
ekimotik ecchymoticmorarmış, çürümüş (kanama)
ekimozecchymosismorluk, çürük (kanama)
ekino-equine-ata benzer ör. pes ekinovarus
ekip teamtakım
ekipman equipmentdonanım
ekivalan equivalenteşdeğerlilik
eklampsieclampsiagebelikbastı
eko-echo-yankı ör. ekolali
ekojenik echogenicyankılayan
ekolaliecholaliayankılama
ekolojiecologyçevre bilimi
ekopraksiechopraxiayansılama
eks-ex-dış ör. ekspirasyon
eksantrikeccentric1. ayrıksı 2. merkez dışı
eksaserbasyon exacerbationazma (sayrılık)
eksfoliyatifexfoliativesoyulgan
eksfolyanexfoliantderisoyar
ekshalasyon exhalationsoluk verme
ekshumasyonexhumation mezar açımı, feth-i kabir
eksibisyonizmexhibitionismgöstermecilik
eksitabilite excitabilityuyarılganlık
eksitasyonexcitation1. uyarma 2. taşkınlık
eksitotoksinexcitotoxinuyarır zehir
eksitotoksisiteexcitotoxicityuyarı ağulanması
eksitusexitus1. ölüm 2. çıkış
eksizyon excisionkesip çıkarma
eksizyonel biyopsiexcisional biopsytüm parçaalım
ekskresyon excretiondışatım
ekspansiyon expansion genişleme
ekspektoran expectorantbalgamsöktürür
ekspektorasyon expectorationbalgam söktürme
eksperimentexperimentdeney
eksperimental experimentaldeneysel
eksperimentalizmexperimentalismdeneyimcilik
ekspirasyonexpirationsolukverim
ekspiratuvarexpiratorysolukverim (ilişkili)
ekspiriyum expiriumsolukverim
eksplantasyonexplantationdış ekim, vücut dışı ekim.
eksploratuvar exploratory1. inceleyici 2. gözden geçirici
ekspojurexposure1.açığa çıkarma (cerrahi) 2. maruz bırakma
ekspozisyon expositionsergileme
ekspülsiyonexpulsiondışa atım
ekstansiyonextension1. gerilme 2.uzama 3.doğrulma 4.genişleme
ekstansör extensor1. geren 2.uzatan 3.doğrultan
ekstaziecstasyesrime
eksteriyor exteriordış bölüm
eksternal external1. dış 2.dışarlı
eksternalizasyonexternalizingdışsallaştırma
ekstirpasyon extirpationbütünüyle çıkarım
ekstra-extra-dış, dışında ör. ekstrakorporal
ekstrahepatikextrahepatickaraciğer dışı
ekstrakorporal extracorporealbeden dışı
ekstrakraniyalextracranialkafatası dışı
ekstraksiyon extraction1. çekçıkar 2. özütleme
ekstraktörextractorçekçıkarır
ekstramedülerextramedullarykemik iliği dışı
ekstramedüler hematopoiezextramedullary hematopoiesiskemik iliği dışı kan yapımı
ekstramüralextramuralduvar dışı
ekstranodalextranodaldüğüm dışı
ekstransplantasyonexplantationdış ortamdan nakil
ekstraselüler extracellulargöze dışı
ekstrasistolextrasystoleerken vuru
ekstrauterinextrauterinedölyatağı dışı
ekstravaskülerextravasculardamar dışı
ekstravazasyon extravasationdışa sızım (damar, idrar yolu)
ekstraversiyon extraversiondışa dönüklük
ekstravert extravert1. dışa dönük 2. dışa açık (kişilik)
ekstre extractözüt
ekstrem extreme1. uç 2. aşırı
ekstrensek extrinsicdışsal
ekstroversiyonextroversiondışa dönüklük
ekstrovertextrovertdışa dönük
ekstübasyon extubationboru çıkartımı
eksüda exudateyangı sıvısı
eksüdasyon exudationyangısal sızıntı
EKTelectroconvulsive therapyelektrokonvülzif tedavi, elektroşok sağaltımı
ektaziectasiagenişleme
-ektazi-ectasia genişleme ör. bronşektazi
ektazikectasicgenişlemiş
ekto-ecto-dış ör. ektoderm
ektodermectodermdış katman, dış yaprak
ektokardiectocardiadışarlak yürek
-ektomi-ectomykesçıkart ör. pnömonektomi
ektoparazitectoparasitedış asalak
ektopiectopykonum dışı
ektopikectopickonum dışılık
ektopik gebelikectopic pregnancydış gebelik
ektopik vuruextrasystole, ectopic beat, premature beat,erken vuru
ektropiyonectropiondışa dönük göz kapağı
ekzantem subitumexanthema subitum altıncı hastalık
elastik elasticesnek
elastisite elasticityesneklik
elasyonelationduygu yükselimi
eldiven anestezisiglove anesthesiaeldivenimsi duyusuzluk
elefantiyaziselephantiasisfil hastalığı
elektifelectiveseçmeli
Elektra kompleksiElectra complexElektra karmaşası
elektriksel alternanselectrical alternanselektriksel değişimli
elektro-electro-elektrik ör. elektroforez
elektrodermal tepkielectrodermal responseelektriksel deri tepkisi
elektroensefalografelectroencephalographbeyin elektrik çizgeci
elektroensefalografielectroencephalographybeyin elektrik çizgelemesi
elektroensefalogramelectroencephalogrambeyin elektrik çizgesi
elektroforezelectrophoresiselektrikle ayrıştırma
elektrokardiyografelectrocardiographyürek elektrik çizgeci
elektrokardiyografielectrocardiographyyürek elektrik çizgelemesi
elektrokardiyogramelectrocardiogramyürek elektrik çizgesi
elektrokonvülzif terapielectroconvulsive therapyelektroşok sağaltımı
elektrokoter electrocauteryelektrikle dağlayıcı
elektrokoterizasyon electrocauterizationelektrikle dağlama
elektromiyografelectromyographkas elektrik çizgeci
elektromiyografielectromyographykas elektrik çizgelemesi
elektromiyogramelectromyogramkas elektrik çizgesi
elektrookülografelectrooculographgöz elektrik çizgeci
elektrookülografielectrooculographygöz elektrik çizgelemesi
elektrookülogramelectrooculogramgöz elektrik çizgesi
elektrotleadakımtaşır
elektroterapielectrotherapyelektrikle sağaltım
elektroversiyonelectroversionelektrikle düzeltme
elemanter halüsünasyonelementary hallucinationbasit varsanı
elevasyon elevation1.kaldırma 2. yükselme
elevatörelevatorkaldıraç
ELISA testienzyme-linked immunosorbent assay testenzim bağlantılı immünosorbent tahlili
eliminasyonelimination1. eleme 2. çıkartım 3. seçat
eliminasyon bozukluklarıelimination disordersdışa atım bozuklukları
elipsoitellipsoidyumurtamsı
elongasyon elongationuzatma
EMelectron microscopeelektron mikroskobu
em-em-içinde ör. emboli, embriyon
EMBendomyocardial biopsyendomiyokardiyal biyopsi
embolektomiembolectomytıkaç çıkartımı
emboli embolustıkaç
embolizasyonembolizationtıkaçla(n)ma
embriyoembryoöndölüt
embriyoblastembryoblastöndölüt göze topluluğu
embriyogenezembryogenesisöndölüt gelişimi
embriyologembryologistdöl bilimci
embriyolojiembryologydöl bilimi
embriyon kesesiembryonal sacöndölüt kesesi
embriyopatiembryopathyöndölüt sayrılığı
embriyotoksisiteembryotoxicityöndölüt ağulanması
emeritus emeritus professoratasagun
emetik emetickusturucu
emezisemesis, vomitingkusma
emezis gravidarum emesis gravidarumgebelik kusması
EMGelectromyogramelektromiyogram, kas elektrik çizgesi
-emi (emia)-emi (emia)kanda ör. anemi
emir halüsinasyonucommand hallucinationkomut varsanısı
emisyonemission1.dışa yayım 2.dışa atım
emosyon emotionduygu
emosyon regülasyonuemotional regulationduygu düzenlemesi
emosyonel emotionalduygusal
emosyonel ekspresyonemotional expressionduygu dışavurumu
emosyonel gelişimemotional developmentduygusal gelişim
emosyonel instabiliteemotional instabilityduygusal dengesizlik
emosyonel labiliteemotional labilityduygusal oynaklık
emosyonel matüriteemotional maturityduygusal olgunluk
emosyonel stabiliteemotional stabilityduygusal denge
emosyonel zekâemotional intelligenceduygusal anlak
empatiempathyduygudaşlık, eşduyum
empotansimpotencecinsel güçsüzlük
EMRelectronic medical recordingelektronik tıbbi kayıt
emülsiyonemulsionsıvı asıltı
-en-enoluşmuş, gelişmiş ör. feminen
en(m)-in-içinde ör. enoftalmi, embriyon
enantemenanthemakızarık mukoza döküntüsü
endarteritendarteritisatardamar iç katman yangısı
endeksindexindeks
endemi endemiayöresel sayrılık
endemik endemicyöresel
endikasyon indication1. kullanım alanı 2. gereklilik
endikatörindicatorgösterge, belirteç, indikatör
endo-endo-iç ör. endokrin
endojen endogenousiç kaynaklı
endojen depresyonendogenous depressioniç kaynaklı çökkünlük
endokarditendocarditisyürek iç katman yangısı
endokardiyalendocardialyürek iç katmanı (ilişkili)
endokartendocardiumyürek iç katmanı
endokrinolojiendocrinologyhormon bilimi
endolenfendolymphiç kulak sıvısı
endometritendometritisdölyatağı iç katman yangısı
endometriyomendometriomaçikolata kisti
endometriyumendometriumdölyatağı iç katmanı
endoserviksendocervixdölboynu içi
endoservisitendocervicitisdölboynu içi yangısı
endositozendocytosisgözeiçi alım
endoskopendoscopeiç göreç
endoskopiendoscopyiç göreçleme
endoskopikendoscopiciç göreçlemeyle
endoskopik retrograt kolanjiyopankretikografiendoscopic retrograde cholangiopancreatographyiç göreçlemeyle geriye doğru öd yolu-pankreas görüntülemesi
endoskopik ultrasonografiendoscopic ultrasonographyiç göreçlemeyle ultrasonografi
endotelendotheliumiç kaplar doku
endotelyomendotheliomaiç kaplar doku uru
endotoksinendotoxiniç ağu
endotrakealendotrachealanasoluk borusu içi
endpointendpointson nokta
endüksiyoninductionbaşlatma
endüransendurancedayanıklılık
endürasyon indurationsertlik
enemaenemalavman
enfarktinfarctioniskemik doku ölümü
enfarktüs infarctioniskemik doku ölümü
enfeksiyon infectionbulaş
enfeksiyöz infectiousbulaşkan
enfekte infectedbulaşmış
enfektif infectivebulaşıcı
enfestasyoninfestationasalak bulaşı
enflamasyoninflammationyangı, yangılanma
enflamatuvarinflammatoryyangılı
enflüanza influenzagrip, paçavra hastalığı
enformatikinformaticsbilişim
enfraruj infraredkızılötesi
engraftmanengraftment1.yama tutma 2.yamala(n)ma
enjeksiyon injectioniğne yapma
enjektör syringeşırınga
enkoheransincoherencesabuklama, kelime salatası
enkoprezisencopresisdışkı kaçırma
enoftalmienophthalmusiçlek göz
ensefalitencephalitisbeyin yangısı
ensefalopatiencephalopathybeyin sayrılığı
ensestincestyasak sevi
enstrümaninstrumentaraç
enstrümantasyoninstrumentationaletli çalışma
ENTear-nose-throatkulak burun boğaz
entegrasyon integrationbütünleşme
entellektüalizasyonintellectualizationdüşünselleştirme
entellektüalizmintellectualismdüşünselcilik
enter(o)-entero-bağırsak (ilişkili) ör. enterosel
enteral enteralbağırsak yoluyla
enteritenteritisbağırsak yangısı
enternasyonal ünite international unituluslararası birim
enteroselenterocelebağırsak fıtığı
enteroskopenteroscopebağırsak göreci
enteroskopienteroscopybağırsak göreçleme
entoksikasyonintoxicationağulanma
entoleransintolerancedayanamamazlık
entomo-entomo-böcek ör. entomolog
entomofobientomophobiaböcek korkusu
entomoloji entomologyböcek bilimi
entrensekintrinsiciçsel
entro-entro-içe ör. entropiyon
entropientropyiçten içe çürüme
entropiyonentropioniçe dönük göz kapağı
entübasyonintubationboru yerleştirme
enürezenuresisidrar kaçırma, altını ıslatma
enürezis noktürnaenuresis nocturnagece altına kaçırma
environmentalenvironmentalçevresel
envolüsyonel depresyoninvolutional depressionyaş dönümü çökkünlüğü
enzimenzymebiyolojik tepkileyici
EOGelectrooculogramelektrookülogram, göz elektrik çizgelemesi
eozineosingülboya
eozinofileosinophilgülyuvar
epanşman effusionefüzyon
epi-epi-üstünde ör. epidural
epidemiyoloji epidemiology sağlık araştırma bilimi
epididimepididymiserbezi üstü bez
epidural epiduralbeyin-omurilik sert zarı üstü
epifizepiphysis1. kemikleşme katmanı 2. melatonin salar bez
epigastriyumepigastriumüst orta karın
epikartepicardiumyürek zar iç katmanı
epikriz epicrisisçıkış özeti
epilasyonepilationkılsızlaştırma
epilepsi epilepsytutarık, sara
epileptiformepileptiformtutarıksı
epileptik nöbetepileptic seizuretutarık nöbeti
epilüminansepiluminanceyüzey
epinefrinepinephrineadrenalin
epinöriyumepineuriumsinir dış bağ dokusu
epispadiyas epispadiasüst siyek
epistaksisepistaxisburun kanaması
epistemolojiepistemologybilgi felsefesi
epitelepitheliumdış kaplar doku
epitelyomaepitheliomadış kaplar uru
epitopepitopeantijen belirteci
epizodik bellekepisodic memoryolay belleği
epizotepisodedönem
epizyo-episio-vulva ör. epizyotomi
epizyotomiepisiotomiavulva doğurtma kesimi
EPS electrophysiology studieselektrofizyolojik çalışmalar
eradikasyoneradicationkökünü kazıma
ERCPendoscopic retrograde cholangiopancreatographyendoskopik retrograt kolanjiyopankreatografi, iç göreçlemeyle geriye doğru öd yolu-pankreas görüntülemesi
e-reçetelemee-prescribingelektronik reçeteleme
ereksiyonerectionsertleşme, dikelme
erektilerectiledikelgen
erektil disfonksiyonerectile dysfunctionsertleşme bozukluğu
ergo-ergo-iş ör. ergomani
ergomaniergomaniaişkoliklik
ergometreergometerişölçer
ergometriergometryiş ölçümü
erit-eryth-kırmızı ör. eritem
eritemerythemaderi kızarıklığı
eritema enfeksiyozumerythema infectiosumbeşinci hastalık
eritematözerythematousderi kızarıklığı
eritremierythremiaeritrositemi, polisitemia vera
eritroblasterythroblastöncül alyuvar
eritrofobi erythrophobiayüz kızarma korkusu
eritropoiez erythropoiesisalyuvar yapımı
eritrosit red blood cell, erythrocytealyuvar
eritrosit sedimantasyon hızıerythrocyte sedimentation ratealyuvar çökme hızı
eritrositozerythrocytosiskanbastı
erizipelerysipelyılancık
erken ejakülasyonpremature ejaculationerken boşalma
eroseros1. cinsel içgüdü 2. yaşam içgüdüsü
erotikeroticgörsel cinsel uyarıcı
erotofobierotophobiacinsellik korkusu
erotomanierotomaniasaplantılı sevgi
erotomanik delüzyonerotomanic delusionaşık olunma sanrısı
eroziverosiveaşındırıcı
erozyon erosionaşınma
erratumerratumdüzelti (yazı)
erüpsiyon eruptionkabartılı kızarık deri döküntüsü
erythema infectiosumerythema infectiosumbeşinci hastalık
e-sağlıke-healthelektronik sağlık
-esans-escencegelişme gösteren ör. konvalesans, adölesans
esansiyel essential1. temel 2. nedeni bilinmeyen
esansiyel tremoressential tremorkinetik tremor
eskarescharyara kabuğu
ESLextracorporeal shockwave lithotripsybeden dışı şok dalgasıyla taş kırımı
ESRerythrocyte sedimentation rateeritrosit sedimantasyon hızı, alyuvar çökme hızı
ESWLextracorporeal shock wave lithotripsybeden dışı şok dalgasıyla taş kırımı
eşantiyonpromotional materialtanıtmalık
eşikaltı psikoz sendromusubthreshold psychotic syndromeeşikaltı gerçeklik yitim belirgesi
ETAevent tree analysisolay ağacı analizi, olay ağacı incelemesi
etimolojietymologyköken bilimi
etiyoloji etiology1. neden 2. neden bilgisi
etiyolojik etiologicalnedensel
ETKelectronic medical recordingelektronik tıbbi kayıt
etmoyit kemikethmoid bonekalbur kemiği
etnikethnicbudunsal
EUSendoscopic ultrasoundiç göreçlemeyle ultrason
evaküasyonevacuationboşaltma
evalüasyonevaluationdeğerleme
evantrasyoneventration karın dışına çıkma, eviserasyon
evaporasyonevaporationbuharlaş(tır)ma
EVARendovascular aortic aneurysm repair endovasküler aort anevrizma tamiri, damar içi ana atardamar baloncuğu onarımı
event recorderevent recorderolaykaydeder
eversiyoneversiondışa döndürme
eviserasyoneviscerationkarın dışına çıkım
evok potansiyelevoked potentialuyarılmış gizil güç
evolüsyon evolutionevrim
ex vivoex vivocanlı dışı
exanthema subitum exanthema subitum altıncı hastalık
excursionexcursion1. açılma 2. gezinim
expanderexpandergenişletici (doku, yapı vb.)
fago-phago-yutma ör. fagositoz
fagofobiphagophobiayutma korkusu
fagositphagocyteyutargöze
fagositoz phagocytosisgöze yutumu
-faj(i)-phageyutma ör. disfaji
fako-phaco-1.göz merceği ör. fakosel 2. doğum lekesi ör. fakomatöz
fakomatözphakomatosisgöz-deri-sinir belirgesi
fakoselphacocelegöz mercek fıtığı
faktörfactoretken
falanksphalanxparmak kemiği
fallop tüpüfallopian tubedölyatağı tüpü
fallusphalluserkeklik organı
familyal familialailevi
fantezifantasyhayal gücü
fantom phantomhayalet
fantom ağrısıphantom painhayalet üye ağrısı
fantom tümörphantom tumorhayalet ur
fantom uzuvphantom limbhayalet üye
farenjit pharyngitisyutak yangısı
farenks pharynxyutak
farik ve mümeyyizlikcapable of discriminatingerginlik ve sezginlik
farma(ko)-pharmaco-ilaç ör. farmakoloji
farmakolojipharmacologyilaç bilimi
farmakopepharmacopeiaresmi ilaç bilgisi
farmakovijilanspharmacovigilanceilaç takip sistemi
fasetfacet(te)düz, pürüzsüz yüzey
fasi-faci-yüz (ilgili)
fasikül fascicledemetcik
fasikülasyonfasciculationseyirme
fasilitasyonfacilitationkolaylaştırma
fasiyal facialyüz (ilişkili)
fasiyal paralizifacial paralysisyüz felci
fasyafasciakas kılıfı
fasyotomifasciotomyakkılıf açımı
fatalfatalöldürücü
fatalite fatalityöldürücülük
fatalite oranıfatality rateolgu-ölüm oranı
favizmfavismbakla ağulanması
fazphaseevre
fazikphasicevreli
FDAFood and Drug AdministrationABD Gıda ve İlaç Dairesi
FDGfluorodeoxyglucoseflorodezoksiglikoz
febrilfebrileateşli
febril konvülziyonfebrile convulsionateşli havale
feçes fecesdışkı
feedbackfeedbackgeribildirim, dönüt
fekal fecaldışkısal
fekal-fecal-dışkı ör. fekalom
fekal inkontinansfecal incontinencedışkı kaçırma
fekal kontinansfecal continencedışkısını tutabilme
fekalitfecalithdışkı taşı
fekalomfecalomataşlaşmış dışkı
fekal-oral bulaşmafecal-oral contaminationdışkı-ağız bulaşımı
fekundabilitefecundabilityüreyebilirlik
fekunditefecundityüreyebilme
felaketleştirmecatastrophizingkorkunçlaştırma
femin-femin-dişi ör.feminizasyon
feminenfemininedişil
feminitefemininitydişilik
feminizasyonfeminizationdişileşme
femoralfemoraluyluk bölgesi (ilişkili)
femoral inklinasyon açısıfemoral inclination angleuyluk eğim açısı
femur femur, thigh boneuyluk kemiği
fenestrasyonfenestrationpencereleme
fenomen phenomenongörüngü
fenotipphenotypedış görünüm
fenotipikphenotypicdış görünümsel
fermantasyon fermentationmayalanma
ferment fermentmaya
fern testifern testeğrelti otu testi
ferri-ferridemir (üç değerlikte) ör.ferritin
ferro(i)-ferro(i)-demir (iki değerlikte) ör. ferroprotein
ferrumferrumdemir
fertilfertiledöllegen
fertilitefertilitydöllegenlik
fertilizasyonfertilizationdöllenme
FESSfunctional endoscopic sinus surgeryfonksiyonel endoskopik sinus cerrahisi, işlevsel iç göreçlemeyle sinus cerrahisi
fetalfetaldölütsel
fethikabirexhumationmezar açımı
fetişizmfetishismtapıncakcılık
fetoskopfetoscopedölüt göreci
fetoskopifetoscopydölüt göreçleme
fetörfetorkötü koku
fetör hepatikushepatic fetorkaraciğer yetmezlik kokusu
fetör orisfetor orisağız kokusu
fetüsfetusdölüt, cenin
FEVforced expiratory volumezorlu soluk verme hacmi
FFP1. fresh frozen plasma 2 filtering face piece.1. taze donmuş plazma 2. yüze filtrelenen parça
FFP2 maskeFFP2 maskN95 maske
FFRfractional flow reserveoransal akım yedeği
FIFOfirst in first outilk giren ilk çıkar
FISHfluorescein in situ hybridizationfloresan in situ hibridizasyon, floresanla yerinde melezleme
fiber fiberlif
fibr(o)-fibro-lif ör. fibrin
fibril fibrillifçik
fibrilasyonfibrillationçırpıntı
fibrinfibrinpıhtı lifi
fibrino-fibrino-fibrin (ilgili), pıhtı lifi (ilgili) ör. fibrinoliz
fibrinolitikfibrinolyticpıhtı lifi eritir
fibrinoliz fibrinolysispıhtı lifi erimesi
fibromfibromaiğ göze uru
fibromatozfibromatosisyaygınlaşmış iğ göze uru
fibroplazifibroplasialifsi gelişim
fibrotik fibroticlifleşmiş
fibröz fibrouslifli
fibulafibulakamış kemiği
fiil ehliyeticapacity to actayırt etme gücü
fikir uçuşmasıflight of ideasdüşünce uçuşması
fiksfixedsabit
fiksasyon fixation1. sabitleme 2. saplanma
fiksatörfixersabitleyici
-fil(i)-philia1. eğilim ör. hemofili 2.sever ör. hidrofil 3. sevicilik ör. pedofili
filament filamentiğcik
filiform filiform1. ipliksi 2. zayıf
filiform nabızfiliform pulsezayıf vuru
filtrasyon filtration1. süzme 2. süzülme
filtrat filtratesüzüntü
filtre filtersüzgeç
filum terminalefilum terminaleomurilik son bağı
filyasyonfiliationsaha incelemesi, alan incelemesi
fimbriyafimbriasaçak
fimozisphimosissünnet derisi darlığı, bitiklik
fissürfissure1. çatlak 2. ayrık
fistülfistula1.akarca 2.olağan dışı kanal
fitfit1.atak, nöbet 2.uyma
fito-phyto-bitki ör. fitobezoar
fitobezoarphytobezoarbitkisel topak
fitoterapiphytotherapybitkisel sağaltım
fizik muayenephysical examinationfizik bakı
fizyolojiphysiologyorganizma işlev bilimi
fizyon fissionbölünme
fizyopatolojiphysiopathology sayrılık oluşum bilimi
flambajflambageyalazlama
flankflankböğür
flapping tremor asterixis, flapping tremorkanat çırpıntısı
flashbulb hafızaflashbulb memoryayrıntılı olay belleği
flasiditeflacciditygevşeklik
flasteradhesive tapeyapışkan şerit
flatulansflatulancemide-bağırsak gazı
flatusflatusmide-bağırsak gazı
fleb(o)-phleb-toplardamar ör. flebotomi
flebolit phlebolithtoplardamar taşı
flebotomiphlebotomy1. toplardamar kesisi. 2. toplardamardan kan alma
flegmon phlegmonbağ doku yangısı
fleks-flex-bükülebilir ör. fleksibilite
fleksibılflexiblebükülgen
fleksibilite flexibilitybükülgenlik
fleksiyonflexion bükülme
fleksör flexorbükücü, eğici
fleksura flexurabüküntü
flep  flapsaplı doku
flokülasyonflocculationbulutsu çöküşüm
floresanfluorescentışıkta parlayan, ışık yayan
floroskopifluoroscopyX-ışınıyla bakı
flow cytometerflow cytometerakan gözeölçer
flow cytometryflow cytometryakan göze ölçümü
flowmeterflowmeterakışölçer
flublurredbulanık
flüktüan fluctuantçalkantılı
flüktüasyon fluctuationçalkalanım
FMFfamilial Mediterranean feverfamilyal Akdeniz ateşi, ailevi Akdeniz ateşi
fobiphobiakorku
-fobi-phobiakorku ör. fonofobi
fobikphobickorkulu
fokalfocalodaksal
fokomeliphocomeliafok kollu
fokus focusodak
folie a deuxfolie a deuxpaylaşılmış gerçeklik yitimi
folikülfolliclekesecik
folikül stimülatör hormonfollicle stimulating hormonefolikül uyarıcı hormon
followerfollowerartçı dalgı
fon(o)-phon-ses ör. fonetik
fonetikphoneticses (ilişkili)
fonksiyon functionişlev
fonksiyonelfunctionalişlevsel
fonksiyonellikfunctionalityişlevsellik
fonofobiphonophobiases ve gürültü korkusu
fonokardiyografphonocardiographyürek ses çizgeci
fonokardiyografiphonocardiographyyürek ses çizgelemesi
fonokardiyogramphonocardiogramyürek ses çizgesi
fontanelfontanellebıngıldak
fontikül fonticulusbıngıldak
foramen foramendelik
form formbiçim
-form-formbiçimde, benzer ör. fuziform
formasyon formation1. biçimlenme 2. oluşum
formülaformulabebek sütü
formülasyon formulation1. biçimlendirme 2. bileşimleme
forniksfornix1. kemersi yapı 2. çıkmaz 3. katlantı
forsepsforcepstutçek
forward gruplama forward typingdoğrudan gruplama
fossa fossaçukur
foto-photo-ışık ör. fototerapi
fotofobiphotophobiaışık korkusu
fotokoagülasyonphotocoagulationışıkla pıhtılaştırma
fototerapiphototherapyışık sağaltımı
foveafoveaçukurcuk
FPPSfamilial progressive systemic sclerosisfamilyal progresif sistemik skleroz, ailevi ilerleyici sistemik skleroz
fragman fragmentparça
fragmantasyon fragmentationparçalama
frajil fragilekırılgan
frajilite fragilitykırılganlık
fraksiyon fraction1. parça 2. bölüm 3. kesim
fraksiyonasyonfractionationayrışma
fraktür fracturekırık
frameframeçerçeve, kare kare
FRCfunctional residual capacityfonksiyonel rezidüel kapasite, işlevsel artakalan sığa
frekans frequencysıklık
fremitusfremitusele gelen titreşim
frenulumfrenulumdizgincik
frijiditefrigiditykadın cinsel soğukluğu
frijitfrigidcinsel soğuk (kadın)
friksiyon frictionsürtünme
FRKfunctional residual capacityfonksiyonel rezidüel kapasite, işlevsel artakalan sığa
fronkülfurunclekan çıbanı
frontal frontal1. alna ilişkin 2. önden
frontal düzlemfrontal planekoronal düzlem
frontal kemikfrontal bonealın kemiği
frontal lop sendromufrontal lobe syndromealın lobu belirgesi
frotman friction rubsürtünme sesi
frozenfrozendonuk
frozen section frozen section donukkesit inceleme
fruktozfructosemeyve şekeri
frustrasyonfrustrationengellenme
frustrasyon toleransıfrustration toleranceengellenme dayanıklılığı
FSHfollicle stimulating hormonefolikül stimülatör hormon, folikül uyarıcı hormon
FTAfault tree analysishata ağacı analizi, hata ağacı incelemesi
FTRphysical therapy and rehabilitationfizik tedavi ve rehabilitasyon
-fugal-fugaluzaklaşan ör. santrifügal
fulgurasyonfulgurationşimşekleme
full-timefull- timetam gün
fulminanfulminanttez kötüleşen
fundus fundus 1. dip 2.çanak
fung-fung-mantar ör. fungisit
fungisitfungicide mantarkıran
fungus fungusmantar
funnel effect funnel effecthuni etkisi
furşetfourchetteçatal
fügfugueruhsal kaçış
füziform fusiformiğsi
füzyon fusionkaynaşma
FVKforced vital capacityzorlu vital kapasite, zorlu yaşamsal sığa
GABAgamma-amino butyric acidgama amino bütirik asit
gaitafecesdışkı
galscabiesuyuz
galaktagoggalactagoguesüt artırıcı
galakto-galacto-süt ör. galaktore
galaktoregalactorrheasüt akıntısı
galaktozgalactosesüt şekeri
galaktozemigalactosemiasüt şekeri hastalığı
galo ritmi gallop rhythmdörtnal dizemi
gametgameteeşey gözesi
-gami-gamyeş ör. agami
gangli-gangli-düğüm (sinir veya lenf) ör. gangliyoma
gangliyonganglion1. düğüm 2.sinirçekirdek
gapgaparalık, açıklık
gastr-gastr-mide (ilişkili) ör. gastralji
gastralji gastralgiamide ağrısı
gastrektomigastrectomymide çıkartımı
gastrikgastricmide (ilişkili)
gastrit gastritismide yangısı
gastro-gastro-mide (ilişkili) ör. gastroenterit
gastroenteritgastroenteritismide-bağırsak yangısı
gastroenterolojigastroenterologysindirim bilimi
gastrointestinalgastrointestinal systemgastrointestinal sistem, sindirim sistemi
gastrolavajgastrolavagemide yıkama
gastroparezigastroparesismide felci
gastroskopgastroscopemide göreci
gastroskopi gastroscopymide göreçleme
gastrostomigastrostomymide ağızlaştırması
gategatekapı
gavajgavageborucukla besleme
GBKtemporary loss of consciousnessgeçici bilinç kaybı
GBSGuillain-Barré syndromeGuillain-Barré sendromu, Guillain-Barré belirgesi
GCSGlasgow coma scaleGlasgow koma skalası, Glasgow koma ölçeği
geç ejakülasyondelayed ejaculationgeç boşalma
gen genekalıtlık
gen ekspresyonugene expressiongen ifadesi
gen mutasyonugene mutationgen değişinimi
gendergendertoplumsal cinsiyet
genetik geneticsgen bilimi
genetik sekansgenetic sequencegenetik dizi dizilim
-genez-genesisgelişim, oluşum, değişim, yapım ör. anjiyogenez
genikülergeniculardiz (ilişkili)
genitalgenitalüreme (ilişkili), üreyik
genital organlargenitaliaüreme organları
genitalyagenitalia üreme organları
genitoplastigenitoplastyüreme organı onarımı
genitoüriner genitourinaryüreme-idrar
genomgenomesoykalıtı
genotipgenotypesoyyapı
genotoksisitegenotoxicitysoyyapı ağulandırıcılık
genugenudiz
genu valgusgenu valgusX-bacak
genu varumgenu varum, bowlegO-bacak
geriyatrigeriatricsyaşlılık bilimi
geriyatrikgeriatric1. yaşlı 2. yaşlılıkla (ilişkili)
germisitgermicidemikropkırar, bulaşsavar
gerontofobigerontophobiayaşlanma korkusu
gerontolojigerontologyyaşlanma bilimi
gestaltgestaltbiçim
gestasyongestationgebelik
gestasyonel kesegestational sacgebelik kesesi
geygayeşcinsel erkek
GFglomerular filtration glomerül filtrasyonu, yumakçık süzmesi
GFRglomerular filtration rateglomerül filtrasyon hızı (oranı), yumakçık süzme hızı (oranı)
GGTgamma-glutamyl transferasegamaglutamil transferaz
GHgrowth hormonebüyüme hormonu
GHRFgrowth hormone releasing factorbüyüme hormonu salınım etkeni
GİAtransient ischemic attackgeçici iskemik atak, geçici yetersiz kanlanma atağı
gibozitegibbosityhörgüçlenme
gingiva gingivadiş eti
giro-giro-kıvrım ör. girus
girusgyrusbeyin kıvrımı
GİSgastrointestinal systemgastrointestinal sistem, sindirim sistemi
GKSGlasgow coma scaleGlasgow koma skalası, Glasgow koma ölçeği
glabella glabella kaş arası
glabella refleksiglabella reflexkaş arası tepkesi
glandglandbez
glandula glandulabezcik
glandülerglandularbezsel
gliko-gluco-glikoz (ılgili) ör. glikozüri
glikometreglucometerkan şekerölçer
glikozüriglucosuriaşekerli idrar
gliyagliasinir destek gözesi
gliyozisgliosis gliyalaşma
glob vezikalevesical globeşişkin mesane
globalglobal1. genel 2. küresel
global afaziglobal aphasiagenel lisan yitimi
globus histerikusglobus hystericusboğazda yumru hissi
globüler globularyuvarımsı
G-LOCG-induced loss of consciousnessgravite uyarımlı bilinç kaybı, yer çekimi uyarımlı bilinç kaybı
glokomglaucomakarasu
glomerülglomerulusyumakçık
glomerüler filtrasyonglomerular filtrationyumakçık süzmesi
glomerülonefritglomerulonephritisböbrek yumakçığı yangısı
glos-gloss-dil ör. glosofarengeal
glosofarengealglossopharyngealdil-yutak (ilişkili)
glossusglossusdil
gluteagluteuskalça
glutenglutentahıl proteini
GMPguanosine monophosphateguanozin monofosfat
gnat(o)-gnath(o)-çene ör. gnatiyon
gnatijaw, gnathyçene
gnatiyongnathion, chinçene ucu
gnatoplastignathoplastyçene onarımı
gnozignosiatanıma
GnRHgonadotropine releasing hormonegonadotropin salgılatıcı hormon
goblet hücregoblet cellkadehsi göze
gode pitting edemaçukurcuk bırakan şişlik
gomfozgomphosisgömme eklem (diş)
-gon-gonia açı ör. trigon
gon-gon-diz ör. gonartroz
gonadotropikgonadotropiceşey bezi uyarıcı
gonartritgonarthritisdiz eklem yangısı
gonartrozgonartrosisdiz eklemi kireçlenmesi
gonatgonadeşey bezi
goniyomgoniomasemiyom
gonoregonorrheabelsoğukluğu
GÖRgastroesophageal refluxgastroözofageal reflü, mideden yemek borusuna geri kaçış
GÖRHgastroesophageal reflux diseasegastroözofageal reflü hastalığı, mideden yemek borusuna geri kaçış sayrılığı
GPRLGaussuan process regression learningGauss süreç çıkarım öğrenimi, Gauss süreç regresyon öğrenimi
GPTglutamic pyruvic transaminaseglutamik pürivik transaminaz
gradegradederece
gradyangradientfark
-graf-graphyazıcı, çizgeç ör. elektrokardiyograf
graf-grapho-yazı, çizi ör. grafomani
-grafi-graphyçizgeleme veya görüntüleme ör. elektroensefalografi
grafik graphicsçizge
grafomanigraphomaniayazma-çizme saplantısı
graft-versus-host hastalığıgraft-versus-host diseasekonağa karşı yama sayrılığı
-gram-gramçizge, görüntü ör. elektrokardiyogram, ultrasonogram
grand malgrand malbüyük nöbet
grandiyözgrandiosebüyüklenmeci
grandiyöz delüzyongrandiose delusionbüyüklenme sanrısı
grandiyözitegrandiositybüyüklenmecilik
granülgranuletanecik
granülasyon granulationtaneciklenme
granüler granulartanecikli
granülomgranulomatanecikli yumru
granülositgranulocytetanecikli akyuvar
-grat-grade-e doğru ör. antegrat, retrograt
gravidagravidagebe, gebelik
graviditegraviditygebelik sayısı
greftgraftyama
grimasgrimaceyüz buruşturum
grup groupküme
grup kohezyonugroup cohesiongrup kaynaşması
GSRgalvanic skin resistancegalvenik deri direnci
GTPguanosine triphosphateguanozin trifosfat
gudde glandbez
guideguidekılavuz
guide wireguide wirekılavuz tel
guidelineguidelinekılavuz (kitap vb.)
guiding catheterguiding catheterkılavuz dalgı
gut goutdamla hastalığı
GÜSgenitourinary systemgenitoüriner sistem, üreme-boşaltım sistemi
GVHDgraft-versus-host diseasegreft versus host hastalığı, konağa karşı yama sayrılığı
GYKsmall for gestational agegebelik yaşına göre küçük (bebek)
GYYcongestive heart failuregöllendirici yürek yetersizliği
HAhistaminehistamin
HAAfault tree analysishata ağacı analizi, hata ağacı incelemesi
habismalignantkötücül
habitushabitus1.duruş 2. beden yapısı
habitüel düşükhabitual abortustekrarlayan düşük
HACCPhazard analysis for critical control pointskritik kontrol noktalarında tehlike analizleri
hacimvolumeoylum
hafızamemorybellek
hafıza bozukluğumemory disorderbellek bozukluğu
HALEhealthy life expectancysağlıklı yaşam beklentisi
halitozis halitosisağız kokusu
haluks hallux, big toeayak başparmağı
haluks rigidushallux rigidusayak baş parmak bükülmezliği
haluks valgushallux valgusayak baş parmak kemik çıkıntısı
halüsinasyonhallucinationvarsanı
halüsinojenikhallucinogenicvarsandıran
halüsinozhallucinosisvarsanılama
hamilepregnantgebe
haploithaploidyarı kromozomlu
haptik diskriminasyonhaptic discriminationdokunsal ayırtetme
haptoglobinhaptoglobinhemoglobin bağlar protein
hareketmotion, movementdevinim
haricenexternaldıştan
hariciyegeneral surgerygenel cerrahi
harmoniharmonyuyum
harvestingharvestingelde edim
hasardamagezedelenme
hastapatientsayrı
hastalıkdiseasesayrılık
hastanehospitalsayrıevi
HAVhepatitis A virushepatit A virüsü
hayativitalyaşamsal
Hbhemoglobinhemoglobin
HBOThyperbaric oxygen therapyhiperbarik oksijen tedavisi, yüksek basınç oksijen sağaltımı
HBVhepatitis B virushepatit B virüsü
HCGhuman chorionic gonadotropininsan koryonik gonadotropini
HCMhypertrophic cardiomyopathyhipertrofik kardiyomiyopati, irileşik yürek kas sayrılığı
Hcthematocritalyuvar yüzdesi
HCVhepatitis C virushepatit C virüsü
HDhemodialysishemodiyaliz, kan arıtım
HDLhigh-density lipoproteinyüksek yoğunluklu lipoprotein
hedonihedoniahaz
hedonizmhedonismhazcılık
hekimdoctorsagun
hekto-hecto-yüz birim
hekza-hexa-altı ör. hekzadaktili
hekzadaktilihexadactylyaltı parmaklılık
hekzozhexose altı karbonlu monosakkarit
helikshelixsarmal
helmet hücrehelmet cellmiğfer göze
helyo-helio-güneş ışını ör. helyoterapi
helyoterapiheliotherapygüneşle sağaltım
hema-hema-kan (ilişkili) ör. hemaglütinin
hemafagositozhemaphagocytosiskan göze yutumu
hemaferezhemapheresiskan ayırseç (işlemi)
hemaglütinasyonhemagglutinationkan kümeleşmesi
hemanjiyomhemangiomakan damarı uru
hemartrozhemarthrosiseklem kanaması
hematemezhematemesiskan kusma
hemato-hemato-kan (ilişkili) ör. hematopoiez
hematojenhematogenous1.kan yoluyla 2.kan kökenli
hematokezyahematocheziakanlı dışkı
hematokrithematocritalyuvar yüzdesi
hematologhematologistkan bilimci
hematolojihematologykan bilimi
hematolojikhematologicalkan bilimsel
hematomhematomakan toplağı
hematometrahematometradölyatağına kanama
hematopoetikhematopoietickan yapıcı
hematopoezhematopoiesiskan yapımı
hematürihematuriakanlı idrar
hemi-hemi-yarı, yarım ör. hemianopsi, hemisfer
hemianopsihemianopsy, hemianopsiayarı alan görmezliği
hemiballismushemiballismustek taraflı atma devinimi
hemiblokhemiblockdalcık bloku
hemiparezihemiparesistek taraflı hafif felç
hemiplejihemiplegiatek taraflı felç
hemisferhemisphereyarı küre
hemitorakshemithoraxyarı göğüs boşluğu
hemo-hem(o)-kan ör. hemoliz
hemobiliyahemobiliakanlı öd
hemodilüsyonhemodilutionkan seyrelim
hemodinamikhemodynamicskan dolaşım devinimselliği
hemodiyafiltrasyonhemodiafiltrationkan arıtım-süzdürüm
hemodiyalizhemodialysiskan arıtım
hemofilihemophiliakanarca
hemofiltrasyonhemofiltrationkan süzdürüm
hemofobihemophobiakan korkusu
hemogramhemogramkan göze çizgesi
hemoklip hemoclipdamar tutmacı
hemokromatozhemochromatosisdoku demir birikimi
hemolitikhemolyticalyuvar yıkımı (ilişkili).
hemolizhemolysisalyuvar yıkımı
hemoperitonhemoperitoneumkarın zarı içi kan birikimi
hemoptizihemoptysiskanlı balgam
hemorajihemorrhage, bleedingkanama
hemorajikhemorrhagickanamalı
hemorajik diyatezhemorrhagic diathesiskanama eğilimi
hemoroithemorrhoidsbasur
hemosiderozhemosiderosisdemir birikimi
hemospermihemospermiakanlı ersuyu
hemostatikhemostatickanamadurdurur (kıskaç veya ilaç)
hemostaz hemostasiskanama durdurma
hemotorakshemothoraxgöğüs boşluğunda kan birikimi
hemovijilanshemovigilancekan takip sistemi
HEPA filtrehigh-efficiency particulate air filteryüksek verimli parçacıklı hava süzgeci
heparinizasyonheparinizationheparinleme
hepat(o)-hepat(o)-karaciğer ör. hepatit
hepatikhepatickaraciğer (ilişkili)
hepatithepatitkaraciğer yangısı
hepatojenhepatogenouskaraciğer kaynaklı
hepatolojihepatologykaraciğer bilimi
hepatomegalihepatomegalykaraciğer büyüklüğü
hepatosithepatocytekaraciğer gözesi
hepatosplenomegalihepatosplenomegalykaraciğer-dalak büyüklüğü
hepatotoksikhepatotoxickaraciğer ağular
hepta-hepta-yedi ör. heptoz
heptozheptoseyedi karbonlu (karbonhidrat)
herb-herb-ot
herbalherbalotsu bitki
hereditehereditykalıtım, soya çekim
herediterhereditarykalıtımsal
heredo-heredo-kalıtım
hermafroditizmhermaphroditismerdişilik
herniherniafıtık
herniasyonherniationfıtıklaşma
herniyo-hernio-fıtık (ilişkili) ör. herniyoplasti
herniyoplastihernioplastyfıtık onarımı
herpesherpesuçuk
herpes zosterherpes zosterkuşakça, gece yanığı
hetero-hetero-ayrı, karşı ör. heterogreft, heteroseksüel
heterogreftheterograftayrı tür yaması
heterojenheterogenousayrışık
heterojenikheterogenicayrı türelli
heterojenisiteheterogenicityayrı türellilik
heterokromiheterochromiaayrı renklilik
heterokromikheterochromicayrı renkli
heteroseksüelheterosexualkarşı cinsel
heterotopiheterotopykonum dışılık
heterotopikheterotopickonum dışılı
heterotropiheterotropia, strabismusşaşılık
hezeyandelusionsanrı
hezeyanlı bozuklukdelusional disordersanrısal bozukluk
hıfzıssıhhasanitationsağlık koruma
HITheparin-induced thrombocytopeniaheparinle tetiklenmiş trombositopeni, heparinle tetiklenmiş pulyuvar azlığı
HIVhuman immunodeficiency virusinsan bağışıklık yetersizliği virüsü
hibernasyonhibernationkış uykusu
hibridizasyonhybridizationmelezleme
hibrithybrid1. katışık 2. kırma
hidramniyozhydramnios dölkesesi göllenimi
hidranensefalikhydranencephalicsukafalı
hidrasyonhydrationsıvıyla birleştirme, su ekleme, sıvı desteği
hidro-hydro-su ör. hidrosefali
hidrofilhydrophilsucul, su geçimli, suçeken
hidrofobihydrophobiasu korkusu
hidrofophydrophobe su geçimsiz, suçekmez
hidroklorik asithydrochloric acidtuzruhu
hidronefrozhydronephrosisböbrek göllenimi
hidrops fetalishydrops fetalisyaygın sıvı birikimli dölüt
hidrosalpenkshydrosalpinxsıvı dolu dölyatağı tüpü
hidrosefalikhydrocephalickarıncığı genişlemiş kafalı
hidroselhydrocelesulutorba
hidrostatik basınçhydrostatic pressuresu basıncı
higro-hygro-nem (ilişkili) ör. higroblefarik
higroblefarikhygroblepharicgöz nemlendirici
hijyenhygienesağlık koruma bilgisi
hijyenikhygienicsağlıklı
hikâyehistoryöykü
hilum hilumsap
hilum ovariihilum ovariiyumurtalık sapı
hilushilusgiriş yeri
himenhymenkızlık zarı
himenektomihymenectomykızlık zarı çıkartımı
himenoplastihymenoplastykızlık zarı onarımı
himenotomihymenotomykızlık zarı kesimi
hiper-hyper-yüksek, aşırı, fazla ör. hipertansiyon, hiperdaktili
hiperaktif çocuk belirgesihyperactive child syndromeaşırı hareketli, delişmen, delifişek
hiperaktivitehyperactivityaşırı hareketlilik
hiperakuthyperacuteaşırı ivegen
hiperalimentasyonhyperalimentationyoğun besleme
hiperaljezihyperalgesiaaşırı ağrıduyum
hiperdaktilihyperdactyliafazla parmaklılık
hiperdipsihyperdipsiageçici aşırı susama
hiperekpleksiyahyperekplexiairkilme sayrılığı
hipereksitabilitehyperexcitabilityaşırı uyarılganlık
hiperemezishyperemesisaşırı kusma
hiperemezis gravidarumhyperemesis gravidarumaşırı gebelik kusması
hiperemihyperemiaaşırı kanlanma
hiperestezihyperesthesiaaşırı dokunma duyarlılığı
hiperforihyperphoriagizli yukarı şaşılık
hiperglisemihyperglycemiakan şekeri yüksekliği
hiperhidrozhyperhidrosisaşırı terleme
hiperintenshyperintenseaşırı yoğun
hiperkalemihyperkalemiakan potasyum yüksekliği
hiperkalsemihypercalcemiakan kalsiyum yüksekliği
hiperkapnihypercapniakan karbondioksit yüksekliği
hiperkinetikhyperkineticaşırı devinimli
hiperkinezihyperkinesisaşırı devinim
hiperkloremihyperchloremiakan klor yüksekliği
hiperkortisizmhypercorticismhiperadrenalizm
hiperlipidemihyperlipidemiakan yağı yüksekliği
hipermagnezemihypermagnesemiakan magnezyum yüksekliği
hipermenorehypermenorrheaaşırı âdet kanaması, aşırı aybaşı kanaması
hipermetrophypermetropyakıngörmez
hipermetropihypermetropiayakıngörmezlik
hipernatremihypernatremiakan sodyum yüksekliği
hiperplastikhyperplasticaşırı gelişik
hiperplazihyperplasiaaşırı gelişim
hiperpnehyperpneaderin soluma
hiperpotasemihyperpotassemiakan potasyum yüksekliği
hipersekresyonhypersecretionaşırı salgılama
hiperselülerhypercellularartmış gözeli
hipersensitivitehypersensitivityaşırı duyarlılık
hipersomnihypersomnia uykuculuk
hipersplenizmhypersplenismdalak azgınlığı
hiperstenürihypersthenuriayüksek yoğunluklu idrar
hiperstimülasyonhyperstimulationaşırı uyarım
hipertansiyonhypertensionyüksek kan basıncı
hipertermihyperthermiakontrolsuz sıcaklık artışı
hipertonihypertoniaaşırı gerim
hipertonikhypertonic1. aşırı gerimli 2. aşırı geçişimli
hipertrikozhypertrichosisaşırı kıllanma
hipertrofihypertrophyirileşim
hipertrofikhypertrophicirileşik
hipertrofik kardiyomiyopati hypertrophic cardiomyopathyirileşik yürek kas sayrılığı
hipertrofik obstrüktif kardiyomiyopati hypertrophic obstructive cardiomyopathyirileşik tıkayıcı yürek kas sayrılığı
hipertropihypertropiayukarı şaşılık
hiperventilasyonhyperventilationhızlı-derin soluma
hipervijilanshypervigilanceaşırı uyarılmışlık
hiperviskozitehyperviscosityağdalılık
hipervolemihypervolemiaoylum fazlalığı
hipno-hypno-uyku ör. hipnotik
hipnofobihypnophobiauyuma korkusu
hipnoterapihypnotherapyuyutumla sağaltım
hipnotikhypnoticuyutucu
hipnotizehypnotiseduyutulmuş
hipnozhypnosisuyutum
hipo-hypo-yetersiz, az, alt ör. hiponatremi, hipoderm
hipoaktivitehypoactivityetkinlik azalması
hipodenshypodenseaz yoğun
hipodermhypodermisalt deri
hipofarenks hypopharynx, laryngopharynxalt yutak
hipofizhypophysis, pituitary glandsümüksü bez
hipogastriyumhypogastriumgöbekaltı, altkarın
hipoglisemihypoglycemiakan şeker azlığı
hipogonadizmhypogonadismeşeybezi yetersizliği
hipokalemihypokalemiakan potasyum azlığı
hipokalsemihypocalcemiakan kalsiyum düşüklüğü
hipokinezihypokinesisaz devinim
hipokloremihypochloremiakan klor düşüklüğü
hipokondrihypochondriahastalık hastalığı
hipokondriyakhypochondriachastalık hastası
hipokondriyak delüzyonhypochondriac delusionhasta olma sanrısı
hipokondriyazishypochondriasishastalık hastalığı
hipokromihypochromiaaçık renklilik
hipokromikhypochromicaçık renkli
hipoksihypoxiadoku oksijen yetersizliği
hipoksikhypoxicdoku oksijen yetersiz
hipomagnezemihypomagnesemiakan magnezyum azlığı
hipomanihypomaniahafif taşkınlık
hipomenorehypomenorrheaaybaşı kanaması azlığı, âdet kanaması azlığı
hiponatremihyponatremiakan sodyum düşüklüğü
hipopituitarizmhypopituitarismsümüksü bez yetersizliği
hipopiyonhypopyonirinli göz
hipoplazihypoplasiaaz gelişim
hipoplazikhypoplasticaz gelişik
hipopotasemihypokalemiakan potasyum düşüklüğü
hiposomnihyposomniauyku azlığı
hipospadiyashypospadiasalt siyek
hiposplenizmhyposplenismdalak yetersizliği
hipostazhypostasiskan göllenimi
hipostenihyposteniagüç düşüklüğü
hipostenikhyposthenic1. güçsüz, mecalsiz 2. sıska
hipostenürihyposthenuriadüşük yoğunlukta idrar
hipotansiyonhypotensiondüşük kan basıncı
hipotenarhypothenaraya iç kabartısı
hipotermihypothermiadüşük sıcaklık
hipotezhypothesisvarsayım
hipotonihypotoniaaz gerimli
hipotonik hypotonic1. az gerimli 2. az geçişimli
hipotonik infanthypotonic infantgevşek bebek
hipotropihypotropiaaşağı şaşılık
hipovolemihypovolemiakan hacmi düşüklüğü
hirsütizm hirsutismkadında eril tipi kıllanma
hissedişfeelingduyumsayış
hist(iy)o-hist(i)o-doku ör. histoloji
histerektomihysterectomydölyatağı çıkartımı
histerihysteriaisteri
histerometrehysterometerdölyatağı derinlikölçer
histerometrihysterometrydölyatağı ölçümü
histerosalpingografihysterosalpingographytüpüyle dölyatağı görüntülemesi
histerosalpingo-ooferektomihysterosalpingo-oophorectomyekleriyle dölyatağı çıkartımı
histeroskophysteroscopedölyatağı göreci
histeroskopihysteroscopydölyatağı göreçleme
histerotomihysterotomydölyatağı kesimi
histiyo-histio-doku
histokompatibilitehistocompatibilitydoku uyumu
histolojihistologydoku bilimi
histolojikhistologicdoku bilimsel
histopatolojihistopathologysayrıdoku bilimi
hiyalinhyalinecamsı, yarısaydam
hiyalofobihyalophobiacam korkusu
hiyatal hernihiatal herniamide fıtığı
hiyatushiatusgeçiş deliği, açıklık
hiyatus hernisihiatus herniamide fıtığı
hiyoit kemikhyoid bonedil kemiği
HLAhuman leukocyte antigen insan lökosit antijeni, insan akyuvar antijeni
HMWKhigh-molecular weight kininogen yüksek molekül ağırlıklı kininojen
hoarding bozukluğuhoarding disorderbiriktiricilik bozukluğu
HOCMhypertrophic obstructive cardiomyopathyhipertrofik obstrüktif kardiyomiyopati, irileşik tıkayıcı yürek kas sayrılığı
HOKMhypertrophic obstructive cardiomyopathyhipertrofik obstrüktif kardiyomiyopati, irileşik tıkayıcı yürek kas sayrılığı
holderholdertutaç
holistik tıpholistic medicinebütüncül tıp
holizmholismbütüncüllük
holo-holo-bütün, tam ör. holosistolik
holodiyastolikholodiastolicdiyastolü dolduran
holosistolikholosystolicsistolü dolduran
holosistolik üfürümholosystolic murmursistolü dolduran üfürüm
homeo-homeo-aynı ör. homeostaz
homeopatihomeopathybenzeri benzerle tedavi
homeostazhomeostasisdengelenim, iç ortam kararlılığı
homisithomicideelkıyım
homo-homo-benzer, eş, aynı ör. homozigot, homogreft
homofobihomophobiaeşcinsel korkusu
homogrefthomografttürdeş yama
homojenhomogenous1.aynı yapıda 2.bağdaşık
homojenitehomogeneitybağdaşıklık
homojenizatörhomogenizerbağdaştırıcı
homolateralhomolateralaynı yan
homologhomologueeşdeş
homoseksüelhomosexualeşcinsel
homozigothomozygote eşkalıtım
homunkulushomunculusinsancık
hordeolumstye, hordeolumarpacık
horizontalhorizontalyatay
horizontal düzlemhorizontal planeyatay düzlem
hormonhormonehormon
hornhornboynuz
hosthostkonakçı
hostilitehostilitydüşmanlık
hotpackhotpacksıcak paket
HPLChigh performance liquid chromatographyyüksek performanslı sıvı kromatografisi
HPVhuman papilloma virusinsan papilloma virüsü
HSMhepatosplenomegalyhepatosplenomegali, karaciğer-dalak büyüklüğü
HSVherpes simplex virusherpes simpleks virüsü
HThypertensionhipertansiyon, yüksek kan basıncı
htkhematocritalyuvar yüzdesi
hukuki ehliyetcivil responsibilityayırtım gücü
humerushumeruskol kemiği
humidifierhumidifiernemlendirici
hummafebrile diseaseateşli hastalık
hücrecellgöze
hümoralhumoralsalgısal
ICinspiratory capacityinspiratuvar kapasite, soluk alım sığası
IC50half maximal inhibitory concentrationyüzde elli inhibitör konsantrasyon, yüzde elli yoğunluk önleyici
ICA internal carotid arteryinternal karotis arter, iç şahdamar
ICD1. international classification of diseases 2. implantable cardioverter defibrillator1. uluslararası hastalık sınıflandırması 2. yürek içi dizemdüzeltir (aygıt)
ICH1. intracerebral hemorrhage 2. intracerebral hematoma. 1. intraserebral hemoraji, beyin kanaması 2. intraserebral hematom, beyin içi hematom
ICPintracranial pressureintrakraniyal basınç, kafa içi basınç
ICUintensive care unityoğun bakım birimi
IDDMinsulin-dependent diabetes mellitusinsüline bağımlı diabetes mellitus, insüline bağımlı şeker hastalığı
IEinfective endocarditisenfektif endokardit
IFNinterferoninterferon
Igimmunoglobulinimmünglobülin
IgAimmunoglobulin Aimmünglobülin A
IgDimmunoglobulin Dimmünglobülin D
IgEimmunoglobulin Eimmünglobülin E
IGFinsulin-like growth factorinsülin benzeri büyüme faktörü, insülin benzeri büyüme etkeni
IgGimmunoglobulin Gimmünglobülin G
IgMimmunoglobulin Mimmünglobülin M
IHDischemic heart diseaseiskemik kalp hastalığı, yetersiz kanlanan yürek sayrılığı
ILRimplantable loop recorderyürek içi döngü kaydedici (aygıt)
INRinternational normalized ratiouluslararası normalleştirilmiş oran
IPLintense pulse lightyoğun atımlı ışık
IQintelligence quotientzekâ katsayısı
IUinternational unituluslararası birim
IUGRintrauterine growth retardationintrauterin gelişme geriliği, dölyatağı içi gelişme geriliği
İAintraarticularintraartiküler, eklem içi
İABPintraaortic balloon pumpintraaortik balon pompası, aort içi balon pompası, ana atardamar içi balon pompası
İASinteratrial septuminteratriyal septum, kulakçıklararası bölme
İBSirritable bowel syndromeiritabl bağırsak sendromu, huzursuz bağırsak belirgesi
içe rotasyoninternal rotationiçe döndürme
ididaltbenlik
idantikidenticalözdeş
idantik ikizidentical twinözdeş ikiz
idealizasyonidealizationülküleştirme
identifikasyonidentification1.tanımlama 2.özdeşleştirme
idiyopatikidiopathicnedeni bilinmeyen
idiyosenkratikidiosyncraticözgün duyarlıklı
idiyosenkraziidiosyncracyözgün duyarlık
idrakcomprehensionkavrama
iğne fobisineedle phobiaiğne korkusu
İİABfine needle aspiration biopsyince iğne aspirasyon biyopsisi
-ik-icilişkili ör. diüretik
İKAinternal carotid arteryinternal karotis arter, iç şahdamar
İKBintracranial pressurekafa içi basınç
İKHischemic heart diseaseiskemik kalp hastalığı, yetersiz kanlanan yürek sayrılığı
iktalictalnöbet (ilişkili)
ikterjaundicesarılık
iktiyo-ichtyo-balık ör. iktiyoz
iktiyozichtyosisbalık pulu derisi hastalığı
iktusictusnöbet
İLinterleukininterlökin
-il-ileilişkili ör. febril
İLAhuman leukocyte antigen insan lökosit antijeni, insan akyuvar antijeni
ileostomiileostomykıvrım bağırsak ağızlaştırması
ileumileumkıvrım bağırsak
ileusileusbağırsak sağınımsızlığı
iliyumiliumyan leğen kemiği
iltihapinflammationyangı
ilüzyonillusionyanılsama
İMintramuscularintramüsküler, kas içi
İMA1. inferior mesenteric artery 2. internal mammary artery1.inferiyor mezenterik arter, alt mezenter atardamar 2. internal mamaryan arter, iç meme atardamarı
imagoimagobüyükler imgesi
imajimage1. görüntü 2. imge
imajinasyonimaginationimgelem
iman tahtasısternumgöğüs kemiği
immatürimmatureolgunlaşmamış
immobilimmobiledevinimsiz
immobilizasyonimmobilizationsabitleme
immune-mediatedimmune-mediatedbağışıklık aracılı
immünimmunebağışık
immün(o)- immun- bağışıklık (ilişkili) ör. immünizasyon
immüniteimmunitybağışıklık
immünizasyonimmunizationbağışıklama
immünojenikimmunogenicbağışıklaştıran
immünojeniteimmunogenicitybağışıklılık yetisi
immünolojiimmunologybağışıklık bilimi
immünomediyatörimmune-mediatedbağışıklık aracılı
immünomodülasyonimmunomodulationbağışıklık uyumlaması
immünomodülatörimmunomodulatorybağışıklık uyumlaştırıcı
immünosüpresanimmunosuppressantbağışıklık baskılayıcı (ilaç)
immünosüpresifimmunosuppressivebağışıklık baskılayıcı
immünoterapiimmunotherapyaşı tedavisi, bağışıklık sağaltımı
impaksiyonimpactiontakılma
impaktimpactetki
impedansimpedancedirenç
imperforeimperforate1.doğuştan kapalı 2.delinmemiş
imperfore himenimperforate hymenkapalı kızlık zarı
impermeablimpermeable geçirimsiz
implantimplantekit
implantasyon implantationekim
impresyonimpression1. izlenim 2. çöküntü, 3. bası izi
imprintingimprintingbasımlama
impulsimpulse1. uyarı 2. dürtü
impuls kontrol bozukluğuimpulse control disorderdürtü denetim bozukluğu
impuls kontrolüimpulse control dürtü denetimi
impulsifimpulsivedürtüsel
impulsiviteimpulsivitydürtüsellik
in-in-1. olumsuzluk ör. inaktivasyon, indiferansiyasyon 2. içinde ör. inhalasyon, inokülasyon, in uteri
in silicoin silicosanal ortamda
in situin situyerinde
in uteroin uterodölyatağı içi
in vitroin vitroorganizma dışında
in vitro fertilizasyonin vitro fertilizationorganizma dışında döllenme
in vivoin vivoorganizmada
in vivo desensitizasyonin vivo desensitizationorganizmada duyarsızlaştırma
in vivo karşı karşıya gelmein vivo exposureorganizmada karşı karşıya gelme
inaktifinactive1. eylemsiz 2. etkisiz
inaktivasyoninactivationetkinsizleşme
incisorincisorkesici diş
indeksindex1.dizin 2.liste 3.işaret 4.gösterge
indeks parmakindex fingerişaret parmağı
indeks vakaindex caseilk gösterge olgu
indeksleme indexdizinleme
independent variableindependent variablebağımsız değişken
indiferansiyeundifferentiatedfarklılaşmamış
indikatör indicatorendikatör
indirekt indirectdolaylı
individualindividualbirey
indüksiyoninduction uyartım
indüktörinductor1.başlatıcı, 2.uyartıcı
inertinertasal
inervasyoninnervationsinir donatısı
infantinfantbebek
infantil amneziinfantile amnesiabebeklik anı yitimi
infantil kolikinfantile colicbebeklik sancısı
infantil kompleksinfantile complexçocukluk karmaşası
infantil omnipotansinfantile omnipotenceçocuk erkliliği
infantil otizminfantile autismbebeklik otizmi
infantil uterusinfantil uterusgelişmemiş dölyatağı
infantilizminfantilismbebeksilik
infantisitinfanticidebebekkıran
inferansinferenceçıkarsama
inferiorinferioraşağı
inferolateralinferolateralalt-dışyan
infertilinfertilekısır
infertiliteinfertilitykısırlık
infiltrasyoninfiltrationiçe sızma
inflaksinfluxiç akım
inflowinflow1. içe akış 2. giriş
infra-infra-altında, öte ör. infradiyafragmatik, infraruj
infradiyaframatikinfradiaphragmatic böleç altı (ilişkili)
infraorbitalinfraorbitalgöz altı
infraredinfraredkızılötesi
infrarujinfraredkızılötesi
infundibuluminfundibulum1.huni şeklinde 2.dip
infüzyoninfusiondamardan sıvı aktarımı
inguinalinguinalkasık (ilişkili)
inguinal herniinguinal herniakasık fıtığı
inhalan inhalantuçucu madde
inhalasyoninhalationsolukla alma
inhalerinhalersolumlatıcı
inhibe inhibitedengellenmiş
inhibisyoninhibitionengelleme
inhibitörinhibitorengelleyici
inkârdenialyadsıma

inkarsere herniincarcerated herniaboğulmuş fıtık
inklinasyoninclinationeğim
inkompatibılincompatible1.uyuşmaz, 2.geçimsiz
inkompletincomplete1.tam olmayan 2.tamamlanmamış
inkorporasyonincorporationiçe katım
inkusincusörs kemiği
inkübasyonincubationkuluçka
inletinletgirim
inokülasyoninoculationaşılama
inominatinnominateadsız
inop.inoperableameliyatedilemez
inoperabılinoperableameliyatedilemez
inotropiinotropykasılma gücü
inotropikinotropickasılımetkiler
inovasyoninnovationyenileşim
inovatifinnovativeyenilikçi
inputinputgirdi
insektisit insecticideböcekkıran
inseminasyoninseminationtohumlama
insidans incidencegörülme sıklığı
insizyonincisionkesi
insizyonel biyopsiincisional biopsykesit parçaalım
insizyonel herniincisional herniakesi yeri fıtığı
insomniinsomniauykusuzluk
inspeksiyoninspectiongözle izleme
inspirasyoninspirationsolukalım
inspiratuvarinspiratorysolukalım (ilişkili)
inspiryuminspiriumsolukalım
instabilinstabledengesiz
instabiliteinstabilitydengesizlik
instinctinstinctiçgüdü
insulainsulaadacık
insüflatörinsufflatorgaz üfleyici
intaktintactetkilenmemiş
intensifintensiveyoğun
intensiteintensityyeğinlik
inter-inter-arasında ör. intermediyer, interhemisferik
interaksiyoninteractionetkileşim
interaktifinteractiveetkileşimli
interferansinterference1.parazit 2.karışma
interhemisferikinterhemisphericbeyin yarı küreler arası
interiktalinterictalnöbetler arası
interiyorinterioriç bölüm
interkostalintercostalkaburgalar arası
interloberinterlobarloplar arası
intermediyerintermediateorta, ara
intermitanintermittentaralıklarla gelen, aralıklı
intermitan klodikasyonintermittent claudicationaralıklı topallama
internalinternal1. iç 2.içerli
internalizasyoninternalizationiçselleştirme
internöroninterneuronara sinir gözesi
interpozisyoninterpositionaraya konumlama
interpretasyoninterpretationyorum
interseksüaliteintersexualityerdişilik
interselülerintercellulargözelerarası
interstisyelinterstitialdokular arası
interstisyuminterstitial tissue ara doku
intervalintervalzaman aralığı
interventrikülerinterventricularkarıncıklar arası
intestinalintestinalbağırsak (ilişkili)
intiharsuicideözkıyım
intimaintimadamar iç katmanı
intörninternön hekim, ön sagun
intra-intra-içi, içinde ör. intramüral
intraaortikintraaorticaort içi, ana atardamar içi
intraarteriyelintraarterialatardamar içi
intraatriyalintraatrialkulakçık içi
intradermalintradermalderi içi
intrakardiyakintracardiacyürek içi
intraketintracathiğneli dalgı
intrakoronerintracoronaryyürek taç atardamar içi
intrakorporeyalintracorporealbeden içi
intrakraniyalintracranialkafa içi
intramedülerintramedullary1.kemik iliği içi 2. omurilik içi
intramüralintramuralduvar içi
intramüskülerintramuscularkas içi
intranatalintranataldoğum sırasında
intranükleerintranuclearçekirdek içi
intraokülerintraoculargöz içi
intraoperatifintraoperativeameliyat sırasında
intraovariyenintraovarianyumurtalık içi
intrapartalintrapartaldoğum sırasında
intrapelvikintrapelvicleğen bölgesi içi
intraperitonealintraperitonealkarın zarı içi
intraplasentalintraplacentaldöleşi içi
intraselülerintracellulargöze içi
intraservikalintracervicaldölyatağı boynu içi
intratekalintrathecalbeyin-omurilik sıvısı içine
intratubalintratubaldölyatağı tüpü içi
intrauterinintrauterinedölyatağı içi
intraüretralintraurethralsiyek içi
intravajinalintravaginaldölyolu içi
intravenözintravenoustoplardamar içi
intravezikalintravesicalmesane içi
intrensekintrinsiciçsel
intro-intro-içe ör. introversiyon
introducerintroducergirgeç
introitusintroitusgirim
introjeksiyonintrojectioniçe atım
introspeksiyonintrospectioniçe bakış
introversiyonintroversioniçe dönüklük
introvertintrovert1. içe dönük (birey) 2. içe dönük (organ)
invajinasyoninvaginationiç içe geçme
invaziv invasive1. girişimsel 2. yayılmacı
invaziv radyolojiinterventional radiologygirişimsel radyoloji
invazyoninvasionyayılma
inversiyoninversiontersine dönme
involüsyoninvolutioniçe çekilme
ipsi-ipsi-aynı tarafta ör. ipsilateral
ipsilateralipsilateralaynı yan
İR1.infrared 2. immunological response1. infrared, kızılötesi 2. immünolojik yanıt, bağışıklama yanıtı
ir-ir-1. olumsuzluk ör. irregüler 2. üzerinde ör. irradyasyon
iradewillistenç
irigasyonirrigationyıkama
irigatörirrigatoryıkatımlık
iritabiliteirritability1. huzursuzluk 2. tepkisellik
iritabl bağırsak sendromuirritable bowel syndromehuzursuz bağırsak belirgesi
iritasyonirritation tahriş
irradyasyon irradiationışınlanım
irrasyonelirrationalus dışı
irregülerirregulardüzensiz
irreversibılirreversiblegeri dönüşsüz
irtifa hastalığıaltitude sicknessyükseklik hastalığı
İSHintracerebral hematomaintraserebral hematom, beyin içi hematom
İSKintracerebral hemorrhageintraserebral kanama, beyin kanaması
iskemiischemiayetersiz kanlanma
iskemikischemicyetersiz kanlanan
iskemik periyotischemic periodyetersiz kanlanan dönem
iskiyonischionoturak kemiği
iskiyumischium oturak kemiği
İSTimmunosuppressive therapyimmünosüpresif tedavi, bağışıklık baskılayıcı sağaltım
-ist-istgörüş veya meslek sahibi ör. anatomist
isterik sağırlıkfunctional hearing lossişlevsel duymamazlık
işitme agnozisiauditory agnosiaişitsel tanımazlık
işitme halüsinasyonuauditory hallucinationişitsel varsanı
iştah artırıcıanabolisingözümleyici
İT1. intratracheal 2.intrathecal1. intratrakeal, ana soluk borusu içi 2. intratekal, beyin-omurilik sıvısı içine
-it-idbenzer ör. ovoit
-it(is)-it isyangı ör. sistit
İTAinternal thoracic arteryinternal torasik arter, iç göğüs duvarı atardamarı
İTPidiopathic trombocytopenic purpuraidiyopatik trombositopenik purpura, nedeni bilinmeyen pulyuvar azlığı kanaması
İTSdrug tracking systemilaç takip sistemi
İV1.intravenous 2. intraventricular1. intravenöz, toplardamar içi 2. intraventriküler, karıncık içi
İVFin vitro fertilizationin vitro fertilizasyon, organizma dışında döllenme
İVİGintravenous immunoglobulinintravenöz immünglobülin, damar içi immünglobülin
İVPintravenous pyelographyintravenöz piyelografi, damardan boşaltım sistemi görüntülemesi
İVSinterventricular septuminterventriküler septum, karıncıklararası bölme
İVUSintravascular ultrasonographyintravasküler ultrasonografi, damar içi ultrasonografi
-iyaz(is)-iasissayrılık durumu ör. litiyaz, tenyazis, psöriyazis
İYBmedial collateral ligament mediyal koleteral bağ, diz iç yan bağ
İYEurinary tract infectionidrar yolu enfeksiyonu
-iyen-ianeylem veya düşünce ör. sezaryen
iyonionyükün
iyonikionicyükünle (ilişkili)
iyonizasyonioni yükünleşme
iyontoforeziontophoresisyükün sağaltımı
-izm-ismkapsam, sistem ya da düşünce ör. polimorfizm
izo-iso-eşitlik ör. izotonik
izogrefisografttıpkı ikiz yaması
izoimmünizasyonisoimmunizationeş bağışıklama
izokinetikisokineticeş devinimli
izolasyonisolation1. yalıtım 2. ayırma 3. yalnızlaştırma
izoleisolated1. yalıtık 2. ayrı
izomerisomereşiz
izometrikisometriceş ölçülü
izomorfikisomorphiceş yapılı
izotonik isotoniceş geçişimli
izotopisotopeyerdeş
izotransplantasyonisotransplantationikizinden (tek yumurta) nakil
izovelositeisovelocityeş hız
izovolümetrikisovolumetriceş oylumlu
jamevüjamais vuasla görmedim sanısı
JDMjuvenile diabetes mellitusjüvenil diabetes mellitus, gençlik şeker hastalığı
jejunumjejunumince bağırsak ikinci bölümü
jelgelpelte
-jen (-gen)-genkaynaklanan ör. hematojen
jeneralizegeneralizedyaygın
jenerasyongenerationkuşak
jeneratörgeneratorüreteç
-jenik-genickaynaklanan ör. kardiyojenik, nörojenik, diyabetojenik
jeo-geo-toprak ör. jeofaji
jeofajigeophagiatoprak yeme
jet lagjet lag boylam aşma sersemliği
jigantizmgigantism devlik
jin(o)-gyn-kadın ör. jinofobi
jinekoitgynecoidkadınsı
jinekologgynecologistkadın hastalıkları uzmanı
jinekolog-obstetrisyengynecologist and obstetriciankadın-doğum uzmanı
jinekolojigynecologykadın hastalıkları bilimi
jinekoloji ve obstetrikgynecology and obstetricskadın hastalıkları ve doğum bilimi
jinekomastigynecomastiaeril meme büyümesi
jinofobigynophobiakadın korkusu
jügülerjugularboyun (ilişkili)
jüvenil juvenilegenç
K1. chronic 2. potasium1.kronik, süregen 2.potasyum
kaburgarib eğe kemiği
kâbus bozukluğunightmare disorderkarabasan
kadaverikcadaverickadavra kaynaklı
kadavracadaverölü beden
kadavra donörcadaveric donorcansız verici
kadranquadrantdörtte bir
kafcuffsargan
KAHcoronary artery diseasekoroner arter hastalığı, taç atardamar sayrılığı
kako-caco-kötü ör. kakozmi
kakozmicacosmiakötü koku alma
kala-azarkala-azarkala-azar, dumdum ateşi
kalibrasyoncalibration1. ölçümleme. 2. çap
kalibratörcalibratorölçümlemeci
kalitatifqualitativenitel
kalitatif araştırmaqualitative researchnitel araştırma
kalitequalitynitelik
kalkaneusheel bonetopuk kemiği
kalkenodinicalcaneodyniatopuk ağrısı
kalkülcalculustaş
kalluscallus1. kemik iyileşimi 2. nasır
kalorimetrecalorimeterkaloriölçer
kalpheartyürek
kalp kriziheart attack, myocardial infarctionyürek krizi
kalsifikasyoncalcificationkireçlenme
kalsinoziscalcinosisdoku kalsiyum birikimi
kalüretikkaliureticpotasyum işetir
kalvarya calvariakafatası kubbesi
kamarachamberodacık
kampimetrecampimetergörme alanölçer
kampimetricampimetrygörme alan ölçümü
kamptodaktilicamptodactyly kıvrık parmaklılık
kan diskrazisiblood dyscrasiakan göze bozukluğu
kandidiyazcandidiasispamukçuk
kanin dişicanine toothköpek dişi
kanselöz dokucancellous tissuesüngersi kemik doku
kanser bilimioncologyur bilimi
kanser fobisicancerophobiakanser olma korkusu
kanserasyoncancerationkansersi yozlaşma
kanserojenikcancerogenickanser yapar (madde)
kanserözcancerouskanserimsi
kantitatifquantitativenicel
kantitatif araştırmaquantitative researchnicel araştırma
kantopeksicanthopexygöz kapak askılama
kantoplasticanthoplastygöz kapak onarımı
kantuscanthusgöz kapak köşesi
kanülcannulaborucuk
kanülasyoncanulationborucuk yerleştirimi
kapasitanscapacitanceyüklenim
kapilcapillussaç
kapilercapillary1. kılcal 2. kılcal damar
kapitatcapitate1. baş şeklinde 2. en büyük el bilek kemiği
kapitulumcapitulumkemik başcığı ör. kapitulum humeri
kapitulum humericapitulum humerikol kemiği başı
kapnometrecapnometernefeste karbondioksitölçer
kapnometricapnometrynefeste karbondioksit ölçümü
kaput headbaş
kaput kuadratumcaput quadratumdörtköşe kafa
kaput suksadaneumcaput succedaneumşiş kafa
karakteristikcharacteristicayırt edici
kararsız anjina pektorisunstable angina pectoriskararsız göğüs ağrısı (yürek)
karbonkülcarbuncleaslanpençesi
kardinal cardinalana
karditcarditisyürek yangısı
kardiyacardiamide girişi
kardiyakcardiacyürek (ilişkili)
kardiyak allograft vaskülopaticardiac allograft vasculopathyyürek türdeş yama damar sayrılığı
kardiyak arestcardiac arrestyürek durması
kardiyak outputcardiac outputyürek debisi
kardiyak resenkronizasyon tedavisicardiac resynchronization therapyyürek eş zamanlama sağaltımı
kardiyak tamponatcardiac tamponadeyürek baskılanması
kardiyektazicardiectasisyürek genişlemesi
kardiyektomicardiectomy1. mide girişi çıkarımı 2. yürek çıkarımı
kardiyo-cardio-yürek (ilişkili) ör. kardiyolog
kardiyofobicardiophobiayürek sayrılığı korkusu
kardiyojenikcardiogenicyürek kaynaklı
kardiyologcardiologistyürek bilimci
kardiyolojicardiologyyürek bilimi
kardiyomegalicardiomegalyyürek büyüklüğü
kardiyomiyektomicardiomyectomyyürek kas çıkartımı
kardiyomiyopaticardiomyopathyyürek kas sayrılığı
kardiyomiyotomicardiomyotomyyürek kas kesimi
kardiyoplejicardioplegyyürek durdurma
kardiyopulmonercardiopulmonaryyürek-akciğer (ilişkili)
kardiyorespiratuvarcardiorespiratoryyürek- solunum sistemi (ilişkili)
kardiyotoksikcardiotoxicyürek ağular
kardiyotomicardiotomyyürek kesimi
kardiyotonikcardiotonicyürek güçlendirici
kardiyotorasikcardiothoracicyürek-göğüs (ilişkili)
kardiyovaskülercardiovascularyürek-damar (ilişkili)
kardiyoversiyoncardioversionyürek dizem düzeltimi
karinacarinatümsek
karnikcarnicet (ilişkili)
karnofobicarnophobiaet tiksintisi
karotis carotidşahdamar
karpal carpalel bilek (ilişkili)
karpal tünel sendromucarpal tunnel syndromeel bileğinde sıkışma belirgesi
karpopedal spazmcarpopedal spasmel-ayak kasılımı
karsinogenez(is)carcinogenesiskanserleşme
karsinoitcarcinoidkanserimsi
karsinoit sendromcarcinoid syndromekanserimsi belirge
karsinojencarcinogenkanserleştirici
karsinojenite carcinogenicitykanserleştiricilik
karsinoliziscarcinolysiskanser yıkımı
karsinomcarcinomakötücül epitel uru
karsinomatözcarcinomatouskansersi
kartilaginözcartilaginouskıkırdaksı
kartilajcartilagekıkırdak
kartilajiniformcartilaginiformkıkırdaksı
kartilajinoitcartilaginoidkıkırdaksı
karyo-karyo-çekirdek ör. karyosit
karyositkaryocyteçekirdekli göze
kas distrofisimuscular dystrophykas yozlaşımı
kas rijiditesi muscular rigiditykas sertliği
kaskatcascadesilsile
kastrasyoncastrationkısırlaştırma
kastrasyon kaygısıcastration anxietyiğdişlik kaygısı
kaşeksicachexia, cachexyhastalıklı zayıflık
kaşektikcachectichastalıklı zayıf
kata-kata-karşı, yıkıcı ör. katabolizma
katabolizmacatabolism1.yıkımlama 2.yadımlama
katalepsicatalepsykasılakalım
katapleksicataplexiagevşeyikalım
kataraktcataractakbasma, göz perdesi
katarsiscatharsisiçini dökme
katartikcatharticbağırsakboşaltır
katastrofikcatastrophicdehşet verici, ürkütücü
katastrofizasyoncatastrophizingfelaketleştirme
katatonicatatoniatutulakalım
kateksiscathexisduygusal yatırım
katetercatheterdalgı
kateterizasyoncatheterizationdalgılama
katoptrofobicatoptrophobiaayna korkusu
katotcathodeeksi uç
kaudacauda, tailkuyruk
kaudalcaudal1. kuyruk sokumu (ilişkili) 2. kuyruksu 3. kuyruk tarafı
KAVcardiac allograft vasculopathykardiyak allograft vaskülopati, yürek türdeş yama damar sayrılığı
kaval cavalana toplardamar (ilişkili)
kaverncavernkovuk
kavernözcavernouskovuksu
kavernöz cisimcavernosal corporakovuksu cisim 
kavitasyoncavitationoyma
kavitecavityboşluk
kavumcavumoyuk, boşluk ör. kavum oris
kavum oriscavum orisağız boşluğu
kazeifikasyoncaseationpeynirsi doku ölümü
kazeözcaseouspeynirsi
KBblood pressurekan basıncı
KBBear- nose-throatkulak-burun-boğaz
KBRNchemical, biological, radioactive, nuclearkimyasal, biyolojik, radyoaktif, nükleer
KBTAcoronary computed tomographyangiograhykoroner bilgisayarlı tomografi anjiografi, taçdamar bilgisayarlı kesitçekim damar görüntülemesi
KBYchronic renal failurekronik böbrek yetmezliği, süregen böbrek yetmezliği
KCliverkaraciğer
KDCcardiovascular surgerykalp-damar cerrahisi, yürek-damar cerrahisi
KDDshortwave diathermykısa dalga diyatermi, kısa dalgayla sıcaklık uygulaması
keloitkeloidderimik
kem(o)-chemo-kimyasal ör. kemotaksi
kemoatraktanchemoattractantkimyasal çekici
kemolizchemolysiskimyasal ayrışım
kemoprevantifchemopreventiveilaçlaönler
kemoprofilaksichemoprophylaxisilaçla koruma
kemotaksichemotaxiskimyasal yönelim
kemotaktikchemotactickimyasal yönelimli
kemoterapichemotherapy1. ilaçla kanser sağaltımı 2. ilaçla sağaltım
kemoterapötikchemotherapeutickanser ilacı
kemozischemosisgöz zar şişliği
kera-kera-boynuzsu tabaka ör. keratinizasyon
kerat(o)-kerat-kornea, saydam tabaka ör. keratit, keratokonus
kerataljikeratalgiasaydam tabaka ağrısı
keratinkeratinboynuzsu madde
keratinizasyonkeratinizationboynuzsulaşma
keratitkeratitissaydam tabaka yangısı
keratokonuskeratoconussaydam tabaka sivrileşmesi
keratomilözkeratomileusiskornea biçimlendirme
keratoplastikeratoplastysaydam tabaka nakliı
kernikteruskernicterusbeyne sarılık çökmesi
keto-keto-keton ör. ketonüri
ketonüriketonuriaketon işeme
keylitcheilitis, chilitisdudak yangısı
keymatofobicheimatophobiasoğuk korkusu
KFcystic fibrosiskistik fibröz
bone marrowkemik iliği
KİBASincreased intracranial pressure syndromekafa içi basınç artışı sendromu, kafa içi basınç artışı belirgesi
kifo-cyph-kambur ör. kifoskolyoz
kifoplastikyphoplastyomur düzeltimi
kifoskolyozkyphoscoliosisyan eğrili kamburluk
kifozkyphosiskamburluk
kilo-kilo-bin ör. kilogram
kindling etkikindling effecttutuşma etkisi
kine(to)-kine-hareket ör. kinestezi
kinestetik varsanıkinesthesic hallucinationdevinimsel varsanı
kinetik tremor kinetic tremordevinim titremesi
kinkkinkbüküm
kirismuschirismusel kasıncı
kiro-chiro-el (ilişkili) ör. kiroplasti
kiromegalichiromegaly, cheiromegalyel büyüklüğü
kiroplastichiroplastyel onarımı
kistcystkese
KİTbone marrow transplantationkemik iliği transplantasyonu, kemik iliği nakli
KKEpersonal protective equipmentkişisel koruyucu ekipman, kişisel koruyucu donanım
KKHcoronary heart diseasekoroner kalp hastalığı, yürek taç atardamar sayrılığı
KKSchronic coronary syndromekronik koroner sendrom, süregen taçdamar belirgesi
KKY1. chronic heart failure 2. congestive heart failure1. kronik kalp yetersizliği, süregen yürek yetersizliği 2. konjestif kalp yetmezliği, göllendirici yürek yetersizliği
klang çağrışımclang associationuyaklı çağrışım
klasifikasyonclassificationsınıflama
klasik şartlanmaclassic conditioningklasik koşullanma
klavikulaclavicleköprücük kemiği
kleftcleftyarık
klempclampkıstırgaç
kleptomanikleptomaniaçalma saplantısı
klevajcleavageyarıklanma
klikclicktık sesi
klimakteriyumclimacteriumyaş dönümü
klino-clino-eğik ör. klinodaktili
klinodaktiliclinodactylyeğik parmaklılık
klinoitclinoidyataksı
klinomaniclinomaniayatma saplantısı
klipsclipskıskaç
klirensclearancetemizle(n)me
klitorimegaliclitorimegalybızır büyüklüğü
klitorisclitoris bızır
klivajcleavageyarıkla(n)ma
KLLchronic lymphocytic leukemiakronik lenfositik lösemi, süregen lenfositik kan kanseri
kloazmachloasmagebelik maskesi
klodikasyonclaudicationtopallama
kloncloneşsoylu
klonlamaclonizationtıpkılama, kopyalama
klonusclonusardışık kasılma
klor(o)-chlor(o)-1.klor iyonu ör. klorizasyon 2. yeşil ör. klorofil
klorizasyonchlorizationklorlama
kloropsichloropsiayeşil görü
klostrofobi claustrophobiakapalı alan korkusu
KLPconsultation-liaison psychiatrykonsültasyon-liyezon psikiyatri, danışım-bağlantılı ruh hekimliği
KMLchronic myeloid leukemiakronik miyeloit lösemi, süregen miyeloit kan kanseri
KMRcardiac magnetic resonancekardiyak manyetik rezonans
KMYbone mineral densitykemik mineral yoğunluğu
knitted graftknitted graftörülmüş yama
ko-co-birlikte, yanında, eş ör. koenfeksiyon, koenzim
KoA coenzyme Akoenzim A
koagülancoagulantpıhtılaştıran
koagülasyoncoagulationpıhtılaşma
koagülopaticoagulopathypıhtılaşma sayrılığı
koagülümcoagulumpıhtı
KOAHchronic obstructive pulmonary diseasekronik obstrüktif akciğer hastalığı, süregen tıkayıcı akciğer sayrılığı
koanachoanaburun arka deliği
koaptasyoncoaptationkavuşum
koarktasyoncoarctationdamar daralımı
koenfeksiyoncoinfectioneşbulaş, birlikte bulaş
koenzimcoenzymeeşenzim
kognisyoncognitionbiliş
kognitifcognitivebilişsel
kognitif fonksiyoncognitive functionbilişsel işlev
kognitif teoricognitive theorybilişsel kuram
kognitif terapicognitive therapybilişsel sağaltım
kognitif yapıcognitive structurebilişsel yapı
kognitif yeticognitive abilitybilişsel yeti
koheranscoherence1.eş evrelilik 2. tutarlılık
kohezyoncohesionyapışma, kaynaşma, bütünleşme
kohortcohortortak öz, dönemdaş
kohort çalışmasıcohort studyortak öz çalışması, dönemdaş çalışması
koilcoilsarmal tıkaç
koilonişikoilonychiakaşık tırnak
koinsidanscoincidenceeş rastlantı
koinsidentalcoincidentaleş rastlantısal
koituscoituscinsel birleşme
koksahip bone, coxakalça kemiği
koksa valgacoxa valgadışa çarpık kalça
koksa varacoxa varaiçe çarpık kalça
koksartrozcoxarthrosiskalça eklemi kireçlenmesi
koksidinicoccydyniakuyruk sokumu ağrısı
koksigodinicoccygodyniakuyruk sokumu ağrısı
koksikscoccyxkuyruk sokumu kemiği
kol(e)-chole-öd, safra ör. kolestaz, kolanjit
kolagogcholagogueödsöktürür
kolajencollagenbağ doku proteini
kolanjitcholangitisöd yolu yangısı
kolanjiyogramcholangiogramöd yolu filmi
kolanjiyotomicholangiotomyöd yolu kesisi
kolapscollapse1. göçme 2.çökme 3.sönme
kolateral collateralyandal (damar veya sinir)
koledokcholedochusöd yolu
koledokoskopcholedochoscopesafra kanalı göreci
koledokoskopicholedochoscopysafra kanalı göreçleme
koleksiyoncollection1.topla(n)ma 2.birikme
kolektifcollective1.toplu 2.ortaklaşa
kolelitcholelithöd taşı
kolelitiyaz(is)cholelithiasisöd taşı sayrılığı
kolelitotomicholelithotomyöd taşı çıkarımı
kolemezischolemesisöd kusma
kolemicholamiaödlü kan
kolerajicholerrhagiaöd akıntısı
koleretikcholereticöd yapar (madde, ilaç)
kolerezischoleresisöd oluşumu
kolesistcholecystöd kesesi
kolesistektomicholecystectomyöd kesesi çıkartımı
kolesistitcholecystitisöd kesesi yangısı
kolesistolityaz(is)cholecystolithiasisöd taşı sayrılığı
kolestatikcholestaticöd tıkanması
kolestatomacholesteatomaöd uru
kolestaz cholestasisöd durgunluğu
kolesterolemicholesterolemiakanda kolesterol yüksekliği
kolikcolicsancı
kolimasyoncollimationışın yönlendirme
kolimatörcollimatorışın yönlendirici
kolircollyriumgöz damlası
kolitcolitiskalın bağırsak yangısı
kollo-diyafizer açıfemoral inclination angleuyluk eğim açısı
kollumcollumboyun
kolo-colo-kalın bağırsak ör. kolonoskopi
koloitcolloidtutkalsı
koloncolonkalın bağırsak
kolonicolonyözdeş küme
kolonizasyoncolonizationözdeş kümelenme
kolonoskopcolonoscopekalın bağırsak göreci
kolonoskopicolonoscopykalın bağırsak göreçleme
kolostomicolostomykalın bağırsak ağızlaştırması
kolostrumcolostrumağız sütü
kolpaljicolpalgiadölyolu ağrısı
kolpektomicolpectomydölyolu çıkartımı
kolpo-colpo-dölyolu, vajina ör. kolpopeksi
kolpopeksicolpopexydölyolu asımı
kolpopitoziscolpoptosisdölyolu sarkması
kolpoplasticolpoplastydölyolu onarımı
kolporaficolporrhaphydölyolu dikilmesi
kolporajicolporrhagiadölyolu kanaması
kolporecolporrheadölyolu akıntısı
kolporeksiscolporrhexisdölyolu yırtılması
kolposkopcolposcopedölyatağı boynu göreci
kolposkopicolposcopydölyatağı boynu göreçleme
kolpotomicolpotomydölyolu kesimi
kombinasyoncombinationbirleşim
kombinecombinedbirleşik
komedoncomedosiyah nokta
komisürcommissurebirleşek
komisürotomi commissurotomybirleşek açımı
kommosyocommotiosarsıntı
komorbiditecomorbidityeşsayrılık
komorbitcomorbideşsayrı
kompaksiyoncompaction1.kilitlenme 2.takılma
kompaktcompact1.sıkı, 2.yoğun
kompansasyoncompensation1. ödünleme 2. dengeleme
kompansatuvarcompensatory1. ödünleyici 2. dengeleyici
kompansecompensated1. ödünlenmiş 2. dengelenmiş
komparatifcomparativekarşılaştırmalı
kompartımancompartment1. odacık 2. bölüm
kompartıman sendromucompartment syndromeodacık basınç artış belirgesi
kompetancompetentyetkin
kompetitifcompetitiveyarışmalı
komplekscomplex1.karmaşık 2. birleşim 3. karmaşa
kompletcompletetam
komplikasyoncomplicationartsorun
komplikecomplicatedkarmaşık
kompliyanscomplianceuyunç
komponentcomponentöge, bileşen
kompozisyoncompositionbileşim
kompozitcompositebileşik
komprescompressbaskıt
kompresörcompressorsıkıştırıcı
kompresyoncompressionbası
komprimecomprimehap
kompülsifcompulsivezorlantılı
kompülsiyoncompulsionzorlantı
komünikan communicantbağlantılı
komünikasyoncommunicationiletişim
komünikasyon becerisicommunication skilliletişim becerisi
komünikasyon bozukluklarıcommunication disordersiletişim bozuklukları
kondansasyoncondensationyoğunlaşma
kondilcondylekemik lokması
kondisyoncondition1.durum 2.koşul
kondisyonelconditionalkoşullu
kondomcondomkılıf
kondr-chondri-, chondro-kıkırdak ör. kondromalazi
kondroitchondroidkıkırdaksı
kondromchondromakıkırdak uru
kondromalazichondromalaciakıkırdak yumuşaması
kondüvitconduityapay-biyolojik yol
konfigürasyonconfiguration1. biçim 2. dizilenim
konfirmasyonconfirmationdoğrulama
konfliktconflictçatışma
konfobülasyonconfabulationmasallama
konfrontasyonconfrontationyüzleştirme
konfüzyonconfusionbilinç bulanıklığı
konizasyonconizationkonik kesim
konjenitalcongenitaldoğuştan
konjestifcongestivegöllendirici
konjestiyoncongestiongöllenme
konjonktivaconjunctivagöz zarı
konjonktivitconjunctivitisgöz zarı yangısı
konjügasyonconjugationbirleşme
konjügeconjugatedbirleşik
konkaconchamidye kabuğu biçiminde (yapı)
konkavconcaveiçbükey
konkomitanconcomitanteşlik eden
konkordanconcordantuyumlu
konkordansconcordanceuyumluluk
konküzyonconcussionsarsıntı
konneksiyonconnectionbağlantı
konnektif dokuconnective tissuebağ dokusu
konnektörconnectorbağlayıcı, bağlantı (donanım)
konsantrasyonconcentration1. yoğunlaşma 2. derişim
konsantratörconcentratoryoğunlaştırıcı
konsantreconcentrated1.yoğunlaşmış 2.derişik
konsantrikconcentriceşmerkezli
konsensüsconsensus1. uzlaşma, 2. oydaşma
konsentconsentonam
konsepsiyonconceptiondöllenme
konseptconceptkavram
konservatifconservative1. muhafazakâr 2. tutucu
konservatif tedaviconservative therapymuhafazakâr sağaltım
konseycouncilkurul
konsolidasyonconsolidation1. pekişme 2. katılaşma 3.bütünleştirme
konstantconstantsabite
konstipasyonconstipationpeklik, kabızlık
konstitüsyonelconstitutionalyapısal, bünyesel
konstriksiyonconstrictionbüzülme
konstriktifconstrictivekısıtlayıcı, daraltıcı
konstriktif perikarditconstrictive pericarditiskısıtlayıcı yürek zar yangısı
konstriktörconstrictordaraltan
konsültanconsultantdanışman
konsültasyonconsultationdanışım
konsültasyon-liyezon psikiyatrisiconsultation-liason psychiatrydanışım-bağlantı ruh hekimliği
kontaminantcontaminantbulaşkan
kontaminasyoncontaminationbulaşma
kontaminecontaminatedbulaşmış
kontentcontentiçerik
kontinücontinuous1.sürekli 2.kesintisiz
kontorsiyoncontortionburulma
kontra-contra-karşıt, zıt ör. kontralateral, kontraseptif, kontrapulsasyon
kontraksiyoncontractionkasılma
kontraktilcontractilekasılabilir
kontraktilitecontractilitykasılabilirlik
kontraktürcontracturebüzülükalım
kontralateralcontralateralkarşı yan
kontrasepsiyoncontraceptiongebelik önleme
kontraseptifcontraceptivegebelikönler
kontrastcontrastkarşıt
kontrast maddecontrast mediagörüntüverir madde
kontrendikasyoncontraindicationkullanım sakıncası
kontrendikecontraindicatedkullanım sakıncalı
kontrfobicontrphobiakorkuya karşı çıkma
kontrolcontrol1.denetim, 2.yeniden değerlendirme
kontrol edilme delüzyonudelusion of controlkontrol edilme sanrısı
kontrpulsasyoncounterpulsationkarşı vurum
kontrtransferans countertransferencekarşı aktarım
konturcontoursınır (organ, tümör, vb.)
kontüzyoncontusionfiziksel örselenme
konuşma terapisispeech therapykonuşma sağaltımı
konvalesansconvalescencetoparlanma
konvansiyonelconventional1.geleneksel, 2.alışılagelmiş
konveksconvexdışbükey
konveksiyonconvectionısı yayımı
konverjansconvergence1.toplanma, 2.yakınsama
konversiyon bozukluğuconversion disorderdönüştürüm bozukluğu
konverting enzimconverting enzymedönüştürücü enzim
konvülziyonconvulsionhavale
kooperasyoncooperationişbirliği
kooperecooperatediletişim kurulabilen, işbirliği yapabilen
koordinasyoncoordinationeşgüdüm
koordinatörcoordinatoreşgüder, eşgüdümcü
kopro-copro-dışkı ör. koprolali
koprofajicoprophagydışkı yeme
koprofobi coprophobiadışkı korkusu
koprolalicoprolaliapis konuşma
kopülasyoncopulationçiftleşme (özellikle insan dışı)
korcor1. yürek 2. özek
kor-cor-yürek ör. korpulmonale
kor bovinumcor bovinumöküz yüreği
kor triatriyatumcor triatriatumüç kulakçıklı yürek
kord-chord-bağ ör. kordosentez
kordachorda, chordae tendinaekalp kapak bağı
kordaplastichordaplastykalp kapak bağ onarımı
kordoncordbağ
kordosentezcordocentesisgöbek bağından örnekleme
korechoreasilkinmeli devinim
koreatetozchoreatethosissilkinmeli - yılankavi devinim
korelasyoncorrelationbağıntı
korelecorrelatedbağıntılı
koriyonchoriongebelik dış zarı, dölörtüsü
korizacoryzaivegen burun yangısı
korneacorneasaydam tabaka
kornea halkasıarcus corneayaşlılık halkası
korneumcorneumboynuzumsu
kornikulumcorniculumboynuzcuk
kornuhorn boynuz
korona crowntaç
koronalcoronalyanay-dikey
koronal düzlemcoronal planefrontal düzlem
koroner anjiyograficoronary angiographykoroner arter görüntülemesi, taç atardamar görüntülemesi
koroner artercoronary arterytaç atardamar
koroner sinüscoronary sinustaç toplardamar boşluğu
koroner vencoronary veintaç toplardamarı
koronoitcoronoidtaçsı
korozivcorrosivekimyasal aşındırıcı
korozyoncorrosionkimyasal aşınma
korporelcorporealbedensel
korpusbody, corpus1. gövde 2.cisim
korpus albikanscorpus albicansak cisim
korpus hemorajikumcorpus hemorrhagicumkanamalı cisim
korpus luteumcorpus luteumsarı cisim
korpüskülcorpusclecisimcik
korpüskülercorpuscularcisimcikli
kort vokalvocal cordses teli
kortekscortexdış katman
kortikalcortical1. beyin korteksi, beyin kabuğu (ilişkili) 2.kabuksal
kortikal körlükcortical blindnessbeyinsel körlük
kortikal sağırlıkcortical deafnessbeyinsel sağırlık
koryo-chorio-dölüt zarı (ilişkili) ör. koryoamniyonit
koryoamniyonitchorioamnioitisdölüt zarı yangısı
koryokarsinomchoriocarcinomadölörtüsü kötücül uru
kostarib, costakaburga
kost-efektifcost-effectivemaliyet-etkin
kosto-costo-kaburga, eğe kemiği (ilişkili)
kotrib, costakaburga, eğe kemiği
kotercauterdağlaç
koterizasyoncauterizationdağlama
kotiledoncotyledondöleşi adası
kovalancovalentortak değerli
kovaryanscovarianceortak değişkenlik
KPBcardiopulmonary bypasskardiyopulmoner baypas, yürek-akciğer köprülemesi
KPEcardiopulmonary exercisekardiyopulmoner egzersiz, yürek-akciğer alıştırma
KPETcardiopulmonary exercise testkardiyopulmoner egzersiz testi, yürek-akciğer alıştırma testi
krampcrampkasınç
krani(yo)-cranio-kafa tası ör. kraniyostenoz
kraniyalcranial1. başa ait 2. başa doğru
kraniyal sinircranial nervekafa çifti
kraniyosinostozcraniosynostosiserken kapanmış şekli bozuk kafatası
kraniyostenozcraniostenosiserken kapanmış şekli bozuk kafatası
kraniyotomicraniotomykafatası açımı
kraniyumskullkafatası
kreatin clearancecreatine clearancekreatin temizlenmesi
kremnofobicremnophobiauçurum korkusu
krepitasyoncrepitationçıtırdama
kresentik crescentichilalimsi
kreşendocrescendogiderek artan
kribriformcribriformeleksi
kriminalcriminalsuç (ilişkili)
kriminal düşükcriminal abortusyasa dışı düşük
kriminolojicriminologysuç bilimi
kriptcrypta1.saklı 2.girinti
kriptoftalmosablepharongöz kapağı yokluğu
kriptojenikcryptogenicnedensiz
kriptorşidizmcryptorchidisminmemiş erbezi
kristacrestibik
kristalcrystal1.billur 2.kum
kristalizecrystalizedbillurlaşmış
kritercriterion, criteria ölçüt
kritik critical1. ciddi 2. tehlikeli
kriyo-crio-donmuş ör. kriyopresipitat
kriyocerrahicryosurgerydondurkes
kriyoprezervasyoncryopreservationdondurkoru
kriyoterapicryotherapydondurarak sağaltım
krom(o)-chrom(o)-renk ör. akromatopsi
kronikchronicsüregen
kronik obstrüktif akciğer hastalığıchronic obstructive pulmonary diseasesüregen tıkayıcı akciğer hastalığı
krono-chrono-zaman ör. kronotropik
kronolojichronologytarih sırası
kronolojik yaşchronological agetakvim yaşı
kronometrechronometersüreölçer
kronotropikchronotropichızetkiler
kros-klempcross-clampçapraz kıstırgaç
krusiyat cruciate haçımsı
ksanto-xantho-sarı
ksantomxanthoma1. sarı plak 2. sarı topak
ksero-xero-kuru, kuruluk ör. kseroftalmi
kserodermaxerodermakuru deri
kseroftalmixeropthalmiakuru göz
ksifoyitxiphoidgöğüs kemik ucu
blood glucosekan şekeri
kuadri-quadri-dört ör. kuadripleji
kuadrigeminequadrigeminydörde bir
kuadrigemine ritimquadrigeminal rhythmdörde bir dizem
kuadriküspitquadricuspiddört yaprakçıklı
kuadriplejiquadriplegiadörtlü felç
kuadroanopsiquadranopsiaçeyrek alan görmezliği
kuartilquartiledörtte birlik
kubitalcubitaldirsek (ilişkili)
kubitus valguscubitus valgusdışa çarpık dirsek
kubitus varuscubitus varusiçe çarpık dirsek
kuplet vurucouplet ectopic beatsikili erken vuru
kurvatürcurvatureyay, kavis
kuvözincubatoryaşanak
küboit cuboidkübik
küçük tansiyondiastolic blood pressuregevşem kan basıncı
-kül-cle, -culeküçük, -cik eki ör. divertikül, vezikül, ventrikül
kültürculture1.kültür 2.ekim
kümülasyoncumulationbirikim
kümülatifcumulativetoplu
küneyiformcuneiformkamamsı
küneyiform kemikcuneiform bonekamamsı kemik
künt afektblunted affectsığ duygulanım
kürcuretam sağaltım
küratifcurative1.sağaltıcı 2. iyileştirici
küretcurettesıyırgaç
küretajcurettagekazıküre
kürtajcurettagekazıküre
küspiscuspisyaprakçık
küspitcuspidyaprakçıklı
KVAAwireless body area networkkablosuz vücut alan ağları
KVCcardiovascular surgerykardiyovasküler cerrahi, yürek-damar cerrahisi
KYBBcoronary intensive care unitkoroner yoğun bakım birimi
LAleft atriumsol atriyum, sol kulakçık
la belle indifferencela belle indifferencegüzel aldırmazlık
LAAleft atrial appendixsol atriyal apandiks, sol kulakçık kör eki
lablaboratorylaboratuvar
labi-labi-dudak (ilişkili) ör. labiyonazal
labillabile1.oynak 2. değişken
labilitelability1. oynaklık 2. değişkenlik
labirentlabyrinthdolambaç
labiyonazallabionasaldudak-burun (ilişkili)
labiyumlabiumdudak
laboratuvarlaboratorydeneylik
labrum labrum dudağımsı
LADleft anterior descending arterysol anterior desandan arter, sol ön inen atardamar
lakri-lacri-gözyaşı ör. lakrimasyon
lakrimallacrimalgözyaşı (ilişkili)
lakrimasyonlacrimation göz yaşarması
laksatiflaxativedışkıyumuşatır
lakt(o)-lact(o)-süt ör. laktojen
laktasyonlactationsütlenim
laktogenezlactogenesissüt yapımı
laktojenlactogensütlendirici
laktojeniklactogenicsütlendiren
laküner amnezilacunar amnesiaboşluklu bellek yitimi
lal(o)-lal(o)-konuşma ör. lalopleji, laliyatri
-lali-laliakonuşma ör. palilali
laliyatrilaliatrykonuşma bozuklukları araştırma ve tedavisi
laloplejilaloplegiakonuşma kasları felci
laminalaminakatman
laminerlaminary1.katmanlı 2.tek yönlü (akım)
laminer kabinlaminar flow cabinetçekerocak
lansetlancetderi delici iğne
LAPlymphadenopathylenfadenopati, akkan bezi büyümesi
laparo-laparo-karın ör. laparoskopi
laparoskoplaparoscopekarın göreci
laparoskopilaparoscopykarın içi göreçleme
laparotomilaparotomykarın açımı
larengofarenkshypopharynx, laryngopharynxalt yutak
larengoskoplaryngoscopegırtlak göreci
larengoskopilaryngoscopygırtlak göreçleme
larenj(go)-laryng-gırtlak (ilişkili) ör. larinjektomi, laringospazm
larenjektomilaryngectomygırtlak çıkartımı
larenjitlaryngitisgırtlak yangısı
larenkslarynxgırtlak
laserasyonlaceration1.parçalı yaralanma 2.parçalı yırtılma
LASIKlaser assisted in situ keratomileusislazer yardımlı yerinde kornea biçimlendirme
latentlatent1.gizli 2.sessiz
latent periyotlatency period1. yanıtsızlık dönemi 2. gizillik dönemi
lateral lateral dışyan
lateral dekübitüs pozisyonulateral decubitus positionyanyatar konum
lateral epikondilittennis elbow tenisçi dirseği
lateral kolateral ligamentlateral collateral ligamentlateral koleteral bağ, diz dış yan bağ
lateralizasyonlateralizationyanlaşma
latero-latero-yan taraf ör. laterodeviyasyon
laterodeviyasyonlaterodeviationdışyana bükülme
laterodorsallaterodorsalsırt-yan
laterolaterallaterolateraldış-yan
lateromediyallateromedialdış-içyan
lateroventrallateroventralön-yan
lavajlavageyıkama
lazer anjiyoplastilaser angioplastylazerle damar açımı
LBBBleft bundle branch blocksol dal bloku
LCLlateral collateral ligamentlateral koleteral bağ, diz dış yan bağ
LCxleft circumflex arterysol sirkümfleks arter, sol taç atardamar sirkümfleks dalı
LD50median lethal doseyüzde elli ölümcül doz
LDH lactate dehydrogenaselaktik dehidrogenaz
LDLlow-density lipoproteindüşük yoğunluklu lipoprotein
L-dopalevodopalevodopa
LE lupus erythematosuslupus eritematozus
LEDlight emitting diodeışık yayan diyot, ışık yayan yarı iletken kaynak
leishmania tropicaleishmania tropicaşark çıbanı
lenflymphakkan
lenf(o)-lymph-akkan ör. lenfadenopati
lenfadenopatilymphadenopathyakkan bezi büyümesi
lenfanjitlymphangitisakkan damar yangısı
lenfanjiyografilymphangiographyakkan damar görüntülemesi
lenfomalymphomakötücül akkan bez uru
lenfoproliferatiflymphoproliferativeakkan çoğalım
lenfositlymphocyteakkanyuvar
lenslensmercek
lent-lent-göz merceği ör. lentikonus
lentikonuslenticonuskonik göz merceği
lepraleprosycüzzam, miskin hastalığı
-lepsi-lepsisnöbet ör. narkolepsi
lepto-lepto-zayıf, ince ör. leptomeningeal
leptomeninks leptomeninxbeyin-omurilik ince-örümceksi zar
letallethalöldürücü
levatorlevatorkaldırıcı
levo-levo-sol, solda ör. levorotasyon
levokardilevocardiasolda yürek
levorotasyonlevorotationsola dönüş
leyo-leio-düz ör. leyomiyosarkom
leyomiyomleiomyomaiyicil düz kas uru
leyomiyosarkomleiomyosarcomakötücül düz kas uru
lezbiyenlesbiansevici, eşcinsel kadın
lezyonlesionörsenti
LGAlarge for gestational agegebelik yaşına göre iri (bebek)
LHluteinizing hormoneluteinleştirici hormon
LIFOlast in first outson giren ilk çıkar
LINAClinear acceleratordoğrusal hızlandırıcı
libidolibido1.yaşam enerjisi 2. cinsel dürtü
ligamanligamentbağ
ligamentopeksiligamentopexybağ asımı
ligantligandbağlanan (molekül, atom vb.)
ligasyonligationbağlama
likefaksiyonliquefactionsıvılaşım
likiditeliquidityakışkanlık
likitliquidsıvı
limitasyonlimitation1.sınırlama 2.kısıtlama
linea albalinea albaakçizgi
linea epifizyalislinea epiphysialis büyüme çizgisi
linea gravidarumlinea gravidarumgebelik çatlağı
linea nigralinea nigrakaraçizgi
lineerlinear1.doğrusal 2.çizgisel
lingu-lingu-dil (ilişkili), dil şeklinde ör. lingulektomi
lingua tonguedil
linguallingualdil (ilişkili)
lingula linguladilimsi
lingulektomi lingulectomydilimsi bölüm çıkartımı (akciğer)
lip(o)-lip-, lipo-yağ ör. lipom
lipazlipaseyağyıkan (enzim)
lipitlipidyağ
lipodistrofilipodystrophyyağ doku yozlaşımı
lipoitlipoidyağsı
lipomlipomaiyicil yağ uru
liposuctionliposuctionyağ emme
lisensefalilissencephalykıvrımsız beyin
lit-lith-taş ör. litotomi
literatürliteraturealanyazın
-litik-lyticortadan kaldıran, eriten ör. anksiyolitik
litolapaksilitholapaxymesane taş kırıp çıkarımı
litotomilithotomy cerrahi taş çıkarımı
litotripsilithotripsytaş kırımı
litotriptörlithotripter taş kırıcı
lityaz(is)lithiasis taş sayrılığı
liyofilizasyonlyophilizationdondurarak kurutma
-liz(is)-lysiserime, parçalanma, yıkım ör. hemoliz
LMAlaryngeal mask airwaylarengeal hava yolu maskesi
LMCAleft main coronary arterysol ana koroner arter, sol ana taç atardamar
LMWHlow-molecular weight heparindüşük molekül ağırlıklı heparin
lobüllobulelopçuk
logo-logo-söz ör. logore
logorelogorrheasöz ishali
-loji-logybilim dalı ör. kardiyoloji
lokallocalyerel
lokal potansiyellocal potentialyerel gizil güç
lokalizasyonlocalizationyerleşim
lokalizelocalizedyerleşimli
loküleloculatedyuvalı
loküslocuskonum, yer
lomber lumbarbel (ilişkili)
lomber herniasyonlumbar herniationbel fıtığı
longitüdinal longitudinal uzun eksende, uzunlamasına
longitüdinal çalışmalongitudinal studyzamana yayılı çalışma
looploopkulp
loop diüretikloop diuretickulp idrarsöker
lordozlordosisomurga ön eğriliği
loşilochianişane, doğum sonu akıntısı
löko-leuko-ak ör. lökosit
lökomoit reaksiyonleukemoid reactionakyuvar tepkimesi
lökopenileukopeniaakyuvar azlığı
lökoplakileukoplakiaakpul
lökoreleukorrheadölyolu akıntısı
lökositleukocyteakyuvar
lökosit formülüdifferential blood countakyuvar dağılımı
lökositozleukocytosisakyuvar artışı
lösemileukemiakan kanseri
LPlumbar punctionlomber ponksiyon, belden su alma
LQTSlong QT syndromeuzun QT belirgesi
LSDlysergic acid diethylamideliserjik asit dietilamit
LSTMlong-short term memeoryuzun-kısa süreli hafıza
lubrikanlubricantkayganlaştırıcı
lubrikasyonlubricationkayganlaştırma
lumb(o)-lumb-bel ör. lumbago, lumbosakral
lumbagolumbagobel ağrısı
lumballumbarbel (ilişkili)
lumbaljilumbalgiabel ağrısı
lumbosakrallumbosacralbel-sağrı (ilgili)
lumbotomilumbotomyböğür kesimi
lumi-lumi-ışık ör. lumirodopsin
lunarlunaray biçiminde. aysı
lupmagnifying glassbüyüteç
lusitropilusitropygevşeme gücü
luteinize edici hormonluteinizing hormonelüteinleştirici hormon
lüksasyonluxationçıkık
lümenlumenborumsu boşluk
LVleft ventriclesol ventrikül, sol karıncık
LVADleft ventricular assist devicesol ventrikül destek cihazı, sol karıncık destek cihazı
LVDDleft ventricular diastolic dysfunctionsol ventrikül diyastolik disfonksiyonu, sol karıncık diyastolik işlev bozukluğu
LVEFleft ventricular ejection fractionsol ventrikül ejeksiyon fraksiyonu, sol karıncık fırlatma yüzdesi
LVMIleft ventricular mass indexsol ventrikül kütle indeksi, sol karıncık kütle göstergesi
LVOTleft ventricular outflow tract sol ventrikül çıkım yolu, sol karıncık çıkım yolu
LVSDleft ventricular systolic dysfunctionsol ventrikül sistolik disfonksiyonu, sol karıncık sistolik işlev bozukluğu
mmetermetre
Mmolarmol
madnessinsanity, madnessdelilik
magnetmagnetmıknatıs
magnifikasyonmagnificationbüyültme
magnitütmagnitude1. büyüklük 2. önem
majik düşünce magical thinkingbüyüsel düşünce
major cross matchmajor cross matchmajor çapraz karşılaştırma
majörmajor1. büyük 2. önemli
makro-macro-büyük ör. makroglosi
makrofajmacrophageyutargöze
makroglosimacroglossiairi dil
makrognatimacrognathiairi çene
makropsimacropsy dev algılama
makrositmacrocyteiri alyuvar
makroskopikmacroscopicgörünür (çıplak gözle)
makrosomimacrosomiairi gövdeli
maksillaupper jawüst çene kemiği
maksillarmaxillaryüst çene (ilişkili)
maksimal maximal1. en çok 2. en yüksek
maksimizasyon maximizationen çoklama, en çoklayım, en çoklatım
maksimummaximum1. en çok. 2. en yüksek.
makülmacule, macula benek
makülamacula luteasarı leke
makülopapülermaculopapularkabartılı benekli
mal-mal-hatalı ör. malabsorpsiyon
mal de Pottspinal tuberculosisomurga veremi
malabsorpsiyonmalabsorptionemilim bozukluğu
maladjustmentmaladjustmentuyum bozukluğu
-malazi-malaciayumuşama ör. osteomalazi
malformasyonmalformation1. oluşum bozukluğu 2.biçim kusuru
malformemalformedbiçim kusurlu
malignmalignantkötücül
malign hipertansiyonmalignant hypertension kötücül yüksek kan basıncı
malign hipertermimalignant hyperthermiakötücül sıcaklık artışı
malignansimalignancykötücüllük
malignitemalignitykötücüllük
malleolmalleol şemik, aşıkcık
malleusmalleusçekiç kemiği
malnütrisyonmalnutritionkötü beslenme
maloklüzyonmalocclusiondişlerin kapanış bozukluğu
malpozisyonmalpositionkötü konum
malpraktismalpracticehatalı tıbbi uygulama
malrotasyonmalrotationkusurlu dönüş
mamm-mamm-meme, meme şeklimde ör. mamografi
mamografimammographymeme görüntülemesi
mandibulamandible, lower jawalt çene kemiği
mandrenmandrindalgı kılavuzu
manimaniataşkınlık
-mani-maniasaplantı ör. kleptomani
manifestmanifest1. belli 2. belirgin
manifest muhtevamanifest contentgörünür içerik
manifestasyonmanifestationgörünür belirti-bulgu
manik atakmanic episodetaşkınlık dönemi
manipülasyonmanipulation1. yönlendirme 2. güdümleme 3. hileyle yönlendirme 4. karşıdakiyle oynama, karşıdakini çıkarı için kullanma. 5. elle kullanma
manometremanometerbasınçölçer
manometrimanometrybasınç ölçümü
manşoncuffsargan
manuelmanual1. el kitabı 2. elle yapılan
manyerizmmannerismanlamsız yüz hareketleri
manyetmagnetmıknatıs
manyetikmagneticmıknatıs gibi
MAO monoamin oxidase monoamin oksidaz
MAPmean arterial pressureortalama arter basıncı, ortalama atardamar basıncı
MAPCAmajor aortopulmonary collateral arteriesmajor aortopulmoner kolateral arterleri, büyük aortopulmoner yandal atardamarları
MAPKAmajor aortopulmonary collateral arteriesmajor aortopulmoner kolateral arterleri, büyük aortopulmoner yandal atardamarları
marasmusmarasmuszafiyet, arıklık
marjmarginsınır
marjinalmarginal1. sınırda 2. sıra dışı
marjinal kişimarginal personayrıksı kişi
marjinasyonmarginationsıradışılaştırma
markırmarkerbelirteç
marsüpiyalizasyonmarsupializationcep ağızlaştırma
maserasyonmacerationyumuşayarak soyulma
masif kanamamassive hemorrhageağır kanama
maskülenmasculineerkeksi
maskülenite-feminitemasculinity-femininityerkeklik-dişilik
maskülenizasyonmasculinizationerkeksileşme
mast-mast-meme ör. mastektomi
mastaljimastalgiameme ağrısı
mastektomimastectomymeme çıkartımı
mastit mastitismeme yangısı
mastodinimastodyniameme ağrısı
mastoitmastoidmeme biçiminde
mastürbasyonmasturbationözdoyum
maternal maternal1.anadan 2.anneye ait
materyalmaterial1.gereç 2.madde
matitematitytok ses
matriksmatrixhücreler arası dolgu
matürmatureolgun
matürasyonmaturationolgunlaşma
matüritematurityolgunluk
mayiliquid, fluidsıvı
maytmite akar
mazoşistmasochistözezer
mazoşizmmasochismözezerlik
MBAmaster of business administrationiş idaresi yüksek lisansı
MBTSmodified Blalock-Taussig shuntmodifiye Blalock-Taussig şant, uyarlanmış Blalock-Taussig şant
MCAmiddle cerebral arteryorta serebral arter, beyin orta atardamarı
MCLmedial collateral ligament mediyal koleteral bağ, diz iç yan bağı
MCSmechanical circulatory supportmekanik dolaşım desteği
MCSDmechanical circulation support devicemekanik dolaşım desteği cihazı
MD1. mitral stenosis 2. doctor of medicine1. mitral darlığı 2. tıp doktoru
MDD1. microwave diathermy 2. mechanical circulation support1. mikrodalga diyatermisi, mikrodalgayla sıcaklık uygulaması 2. mekanik dolaşım desteği
MDDCmechanical circulation support devicemekanik dolaşım desteği cihazı
MDSmyelodysplastic syndromemiyelodisplastik sendrom, kemik iliği yoz yapım belirgesi
medikalmedicaltıbbi
medikal etikmedical ethicstıp etiği
medikal futilitymedical futilityboşa sağaltım
medikasyonmedication1. ilaç sağaltımı 2. ilaç
mediko-medico-tıbbi ör. medikoşirürjikal, medikolegal
meditasyonmeditationzihinsel yoğunlaşma
mediummedium1. orta 2. besiyeri
mediyalmedialiçyan
mediyal kolateral ligament medial collateral ligament mediyal koleteral bağ, diz iç yan bağ
mediyanmedianortanca
mediyan düzlemmedian planeorta hat düzlemi
mediyastenmediastinumorta göğüs boşluğu
mediyastinoskopmediastinoscopeorta göğüs boşluğu göreci
mediyastinoskopimediastinoscopyorta göğüs boşluğu göreçleme
mediyatörmediatoraracı
mediyo-medio-orta ör. mediyolateral
mediyolateralmediolateralorta-dışyan
medullamedulla1. en iç katman 2. ilik
medulla oblongatamedulla oblongata, bulbusomurilik soğanı
medulla spinalismedulla spinalisomurilik
medyamedia1. orta katman 2. ortam, 3. besiyeri
mega-mega-1. milyon ör.megahertz 2. aşırı büyük ör. megakaryosit, megakolon
megakaryositmegakaryocyteanapulyuvar
megakolonmegacolondev kalın bağırsak
-megali-megalybüyüklük ör. kardiyomegali
megalo-megalo-büyüklük ör. megalomani
megalofobimegalophobiabüyük nesne korkusu
megalomanimegalomaniabüyüklenmecilik
megalositmegalocyteiri alyuvar
megasistismegacystisbüyük mesane
mekanik ikterobstructive jaundicetıkanma sarılığı
mekanizma mechanismdüzenek
mekonyummeconiumilk kaka
melan-melan-kara ör. melanom
melankolimelancholiaağır çökkünlük
melanommelanomaben uru (kötücül)
melazmamelasmagebelik maskesi
melenamelena kara dışkı
-meli-melüye ör. fokomeli
membranmembranezar
membranözmembranous1. zarımsı 2. zarlı
menarşmenarcheilk âdet
menenjitmeningitisbeyin zarı yangısı
menenks meninxbeyin-omurilik zarı
menisemenersuyu
meniscusmeniscusmeniskus
meno-meno-âdet ör. menopoz
menopozmenopausedişil yaş dönümü, âdetten kesilme
menorajimenorrhagiaaşırı âdet kanaması
mensmensesâdet
menstrüasyon menstruationâdet
menstürel fazmenstrual phaseâdet dönemi
ment-ment-akıl, zihin, zekâ ör. mental retardasyon
mentalmentalzihinsel
mental retardasyonmental retardationzekâ geriliğI
mental retardementally retartedgeri zekâlı
mentormentoryönder
mentummentum çene kabarığı
merhemointmentsıvağ
MERSMiddle East respiratory syndromeOrta Doğu solunum yetersizliği belirgesi
MERS coronavirusMiddle East respiratory syndrome coronavirus, MERS-CoVOrta Doğu solunum yetersizliği belirgesi nedenli koronavirüs
MERS-CoVMiddle East respiratory syndrome coronavirus,Orta Doğu solunum yetersizliği belirgesi nedenli koronavirüs
mesaneurinary bladdersidik torbası
meşmeshağsı yama
meta-meta-ötesinde, arasında ör. metafizik
metaanalizmeta-analysistoplu çözümleme
metabolikmetabolicözümleme-yadımlama (ilişkili)
metabolik sendrommetabolic syndromemetabolik belirge
metabolitmetaboliteara ürün
metabolizmametabolismözümleme-yadımlama
metafiz metaphysisaragövde
metafizikmetapsychicsfizik ötesi
metaformetaphoreğretileme
metakarpalmetacarpalel tarak kemiği
metalo-metalo-metal ör. metaloprotein
metamorfozmetamorphosisbaşkalaşım
metaplazimetaplasiayoz dönüşüm
metaplazikmetaplasticyoz dönüşük
metastatikmetastaticsıçramalı, yayılımlı
metastaz metastasis sıçrama
metatarsal metatarsalayak-tarak bölgesi
metensefalonmetencephalonartbeyin
meteorizmmeteorismkarın gazı şişkinliği
methemoglobinmethemoglobinmavimsi hemoglobin
metodolojimethodologyyöntem bilimi
metodolojikmethodologicalyöntem bilimsel
metotmethodyöntem
metr(o)-metr-dölyatağı ör. metrosalpenjit
-metre-meterölçer ör. oksimetre
-metri-metryölçüm ör. dansitometri
metritmetritisdölyatağı yangısı
metroplastimetroplastydölyatağı onarımı
metroraji metrorrhagiaâdet dışı kanama
metrosalpenjitmetrosalpingitisdölyatağıyla tüpü yangısı
mevsimsel afektif bozuklukseasonal affective disordermevsimsel duygu durumu bozukluğu
mezanter mesenteryince bağırsak askısı
mezenkimmesenchymadestek bağ dokusu
mezensefalonmesencephalon, midbrainortabeyin
mezenşimmesenchymadestek bağ dokusu
mezo- meso-1. orta ör. mezokardi 2. askı ör. mezosalpinks
mezodermmesodermöndölüt orta katmanı
mezokardimesocardiaortada yürek
mezoovariyummesoovariumyumurtalık bağı
mezosalpinksmesosalpinxtüp bağı
MGmyasthenia gravismiyasteniya gravis
MHCmajor histocompatibility complexbüyük doku uyumu bileşiği
MImyocardial infarctionmiyokart enfarktüsü, yürek krizi
MICminimum inhibitor concentrationminimum inhibitör konsantrasyon, engelleyici en düşük yoğunluk
middiyastolikmiddiastolicdiyastol ortası
midgutmidgutdölüt orta bağırsağı
midriyatikmidriaticgözbebeğibüyütür
midriyazismidriasisgözbebeği büyümesi
midsistolikmidsystolicsistol ortası
migrasyonmigrationgöç
migrenmigraineyarım baş ağrısı, yarımca
MİKminimum inhibitor concentrationminimum inhibitör konsantrasyon, engelleyici en düşük yoğunluk
miko- myco- mantar ör. mikotik
mikolojimycologymantar bilimi
mikotikmycoticmantar (ilişkili)
mikozmycosismantar hastalığı
mikro- micro-1. milyonda bir 2. mini ör. mikrosefali
mikroanjiyopatimicroangiopathydamarcık sayrılığı
mikrobiyolojimicrobiologyminicanlı bilimi
mikrobiyotamicrobiotaminican örtüsü
mikroembolimicroembolusküçük tıkaç
mikroembolizasyonmicroembolizationküçük pıhtılarla tıkaçlanma
mikroftalmimicroopthalmiaküçük göz
mikrognatimicrognathiaküçük çene
mikrografimicrographyminik yazma
mikroinvazivmicroinvasivemikroyayılımlı
mikroinvazyonmicroinvasionmikroyayılım
mikrokardimicrocardiaküçük yürek
mikromanik delüzyonmicromanic delusionküçüklük sanrısı
mikromelimicromeliaküçük/kısa kol/bacak
mikrooftalmimicrophthalmiaküçük göz
mikroorganizmamicroorganismminican
mikropsimicropsiacüce algılama
mikrosefalimicrocephalyküçük kafalılık
mikrosirküitmicrocircuitmini devre
mikrosirkülasyonmicrocirculationkılcal damar dolaşımı
mikrositmicrocytemini alyuvar
mikrositermicrocyticmini alyuvarlı
mikrositikmicrocyticmini alyuvarlı
mikroskobikmicroscopicmini ölçekli
mikroskopmicroscopeminigözler
mikroşirürjimicrosurgerymikrocerrahi
mikrotiyamicrotiagüdük kulak kepçesi
mikrotommicrotomemini-dilimler
mikrovaskülermicrovascularmini damarsal
mikrovilüsmicrovillusmini çıkıntı
miksiyonmictionişeme
mikstmixedkarışık ör. mikst tümör
mikst tip bipolar afektif bozuklukmixed type bipolar affective disorderkarma tip iki uçlu duygu durum bozukluğu
mili- mili-binde bir ör. miligram
miliaryamiliariaisilik
miliyermiliarysepik
milyömillieuortam
mimetikmimeticöykünen
-mimetik-mimeticbenzer etki oluşturan ör. parasempatomimetik
minimal minimalen az, en düşük
minimizasyonminimizationen azlama, en azlayım, en aza indirgemek
minimum minimumen az, en düşük
minor cross matchminor cross matchküçük çapraz karşılaştırma
minörminor1. önemsiz 2. hafif
miringotomimyringotomykulak zarı delme (kesisi, açımı)
mis-mis-yanlış ör. misdiagnoz
misdiyagnozmisdiagnosisyanlış tanı
mismatchmismatchuyumsuzluk
misyonmissionözgörev
mito- mito-ipliksi ör. mitokondri
mitomanimythomaniamasal uydurma saplantısı
mitozmitosiseşeysiz bölünme
mitral valfmitral valvemitral kapak
miyaljimyalgiakas ağrısı
miyastenimyastheniakas güçsüzlüğü
miyektomimyectomykas çıkartımı
miyelinmyelinsinir kılıfı
miyelinizasyonmyelinizationsinir kılıflanması
miyelo- myelo-1. kemik iliği ör. miyelofibröz
2. sinir lifi kılıfı ör. miyelinizasyon
3. omurilik ör. miyelomeningosel
miyelofibroz(is)myelofibrosiskemil iliği bağsılaşması
miyelonekrozmyelonecrosiskemil iliği ölümü
miyelosüpresanmyelosuppressant, myelosuppressivekemil iliği baskılayıcı (ilaç)
miyelosüpresifmyelosupressivekemil iliği baskılayıcı
miyelosüpresyonmyelosuppressionkemil iliği baskılama
miyelotomimyelotomyomurilik kesimi
miyenterikmyentericbağırsak kası ilişkili
miyo- myo-kas ör. miyoglobülinüri
miyofibrilmyofibrilkas lifçiği
miyokarditmyocarditisyürek kas yangısı
miyokardiyalmyocardialyürek kası (ilişkili)
miyokartmyocardiumyürek kası
miyokart enfarktüsümyocardial infarctionyürek krizi
miyoklonusmyoclonuskas atması
miyolizmyolysiskas yıkımı
miyomektomimyomectomydölyatağı kas uru çıkartımı
miyometritmyometritisdölyatağı kas yangısı
miyometriyummyometriumdölyatağı kası
miyopmyope, nearsighteduzakgöremez
miyopatimyopathykas sayrılığı
miyopimyopiauzakgörmezlik
miyoplastimyoplastykas onarımı
miyorölaksanmyorelaxantkas gevşetici
miyositmyocytekas gözesi
miyotomimyotomykas kesisi
miyotonimyotoniakas gevşemezliği
miyozismyosisgözbebeği küçülmesi
miyozitmyositiskas yangısı
mizaçtemperamenthuy
mizofobi misophobiapislik korkusu
MLmachine learningmakine öğrenme
mobbingmobbingbezdiri
mobilmobile1.devinimli 2.taşınabilir 3.gezici
mobilitemobilitydevinimlilik, hareketlilik
modmodetarz
modalitemodalitytarz
modelmodel1.kalıp 2. örnek
modemmodemçevirge
modifikasyonmodification1. değiştirme, 2. değişiklik
modifiyemodifieddeğiştirilmiş
MODSmultiorgan dysfunction syndromemultiorgan disfonksiyon sendromu, çoklu organ işlev bozukluk belirgesi
modülmodulebirim
modülasyonmodulationuyumlama
modülatörmodulatoruyumlayıcı
modülermodularbirimli
MODYMaturity-Onset Diabetes of the Younggençlik tip 2 diyabeti
MOFmultiorgan failuremultiorgan yetmezliği, çoklu organ yetmezliği
mol hidatiformhydatid moleüzüm gebelik
molar dişmolar toothazı dişi
molestasyonmolestationsarkıntılık
monitörmonitorgöstergeç
monitörizasyonmonitoringizleme
mono- mono-bir ör. mononükleer
monofazikmonophasictek evreli
monoklonalmonoclonaltek eşsoylu
mononükleermononucleartek çekirdekli göze
mononükleozmononucleosistek çekirdekli akyuvar çoğalımı
monopolar monopolar1. tek uçlu 2. tek kutuplu
monositmonocytetekyuvar
monoterapimonotherapytekli sağaltım
monozigot ikizmonozygous twineşikiz
monozomimonosomytekli kromozom
monsmonskabartı
moodmoodduygu durumu
mood bozukluklarımood disordersduygu durumu bozuklukları
mood stabilizatörü mood stabilizatorduygu durum dengeleyici
morbiditemorbidity1. hasta olma oranı 2. hastalık 3.bozukluk
morbitmorbidöldürücü
morbit obezitemorbid obesityöldürücü şişmanlık
morfo-morpho-biçim ör. morfoloji, morfogenez
morfogenezmorphogenesis biçimlenme
morfolojimorphologybiçim bilimi
morfolojikmorphologicbiçimsel
mortalmortalölümlü
mortalite oranı mortality rateölüm oranı
morulamoreulaüç günlük öndölüt
motilitemotilityözdevinimlilik
motivasyonmotivationgüdüleme
motivasyonel görüşmemotivational interviewingisteklendirici görüşme
motormotordevinim, hareket
motor afazimotor aphasiadevinimsel lisan yitimi
motor alanmotor areadevinim alanı, hareket alanı
motor gelişimmotor developmentdevinim gelişimi, hareket gelişimi
motor ifademotor expressiondevinimsel anlatım, hareketle anlatım
motor koordinasyonmotor coordinationdevinim eş güdümü, hareket eş güdümü
motor öğrenmemotor learningdevinimsel öğrenme, hareket öğrenmesi
MR 1. magnetic resonance 2. mitral regurgitation1. manyetik rezonans 2. mitral regürjitasyon, mitral yetersizliği
MRG magnetic resonance imagingmanyetik rezonans görüntüleme
MRImagnetic resonance imagingmanyetik rezonans görüntüleme
m-RNAmessenger ribonucleic acidhaberci ribonükleik asit
MRSAmethicillin-resistant Staphylococcus aureusmetisiline rezistan Staphylococcus aureus, metisiline dirençli Staphylococcus aureus
MS1. multiple sclerosis 2. mitral stenosis1. multipl skleroz 2. mitral stenoz, mitral darlığı
MSHmelanocyte stimulating hormonemelanosit stimülatör hormon, melanosit uyarıcı hormon
MSScentral nervous systemmerkezî sinir sistemi
MTBcentral venous pressuremerkezî toplardamar basıncı
muhakeme becerisijudgement abilityyargılama yetisi
muko-muco-1. mukoza ör. mukoepidermoid 2. mukus ör. mukoid, mukopolisakkaridoz
mukoitmucoidsümüksü
mukozamucosasümüksü zar, astar zar
mukusmucoussümüksü salgı
multi- multi-çok, çoklu ör. multifaktöriyel, multinodüler
multidisiplinermultidisciplinaryçok alanlı
multifaktöriyelmultifactorialçok etkenli
multifokalmultifocalçok odaklı
multigravidamultigravidabirden çok gebelik
multikistikmulticysticçok keseli
multilokülermultilocularçok odacıklı
multinodülermultinodularçok düğümcüklü
multinükleermultinuclearçok çekirdekli
multiparmultiparousçok doğurmuş
multiplmultipleçok, çoklu
multipl kişilik bozukluğumultiple personality disorderçoklu kişilik bozukluğu
multiplanmultiplaneçok düzlemli
multipolarmultipolarçok uçlu
multisentrikmulticentricçok merkezli
multislicemultisliceçok kesitli
multivalanmultivalentçok değerlikli
multivaryantmultivariantçok değişkenli
Munchausen belirgesiMunchausen syndromeyapay bozukluk
musofobimusofobiafare korkusu
mutajenikmutagenicgen değiştirici
mutajenitemutagenicitygen değiştiricilik
mutantmutantdeğişmiş gen
mutilasyonmutilationsakatlama
mutizmmutismkonuşmazlık
mümeyyizlikcivil responsibilityayırtım gücü
müpteladependentbağımlı
müralmuralduvarsal
müskülermuscularkas (ilişkili)
müsküler distrofimuscular dystrophykas yozlaşımı
müskülo- musc-kas ör. müskülokütanöz
müskülokutanözmusculocutaneouskas-deri (ilişkili)
müsküloskeletalmusculoskeletalkas-iskelet (ilişkili)
müstahzarregistered drugonaylı ilaç
MVmegavolt1. mitral valf, mitral kapak 2. megavolt
MVP mitral valve prolapsusmitral valf prolapsusu, mitral kapak sarkması
MVRmitral valve replacementmitral valf replasmanı, mitral kapak değişimi
MYmitral insufficiency, mitral regurgitationmitral yetersizliği
N95 maskeN95 maskağız-burun yüksek koruyucu maske
N99 maskeN99 maskağız-burun çok yüksek koruyucu maske
NAnomina anatomicanomina anatomica
NAATnucleic acid amplification testnükleik asit amplifikasyon testi
nabızpulsevuru
NADnicotinamide adenine dinucleotidenikotinamit adenin dinükleotit
NADPnicotinamide adenine dinucleotide phosphatenikotinamit adenin dinükleotit fosfat
nanizmnanismcücelik
nano- nano-milyarda bir, çok küçük ör. nanomeli, nanoteknoloji
nanomelinanomeliaküçük/kısa kol/bacak
narisnostril burun ön deliği
narko- narco-uyku ör. narkolepsi
narkolepsinarcolepsygün uykusu nöbeti
narkotiknarcoticuyuşturucu
narsistnarcissistözsever
narsistik kişilik bozukluğunarcissistic personality disorderözsever kişilik bozukluğu
narsizimnarcissismözseverlik
natifnative1.doğal 2.yerli
natri-natri-sodyum (ilişkili) ör. natriüretik
natriüretiknatriureticsodyumişetir
natriyumnatriumsodyum
natürelnaturaldoğal
navigasyonnavigationyolbul
nazalnasal, nasalisburun (ilişkili)
nazal konkanasal conchaburun konkası
nazo- naso-burun (ilişkili) ör. nazofarenks
nazofarengolarengoskopnasopharyngolaryngoscopeburun-yutak-gırtlak göreci
nazofarenksnasopharynxgeniz
nazogastrik nasogastric burun-mide (ilişkili)
nazogastrik sondanasogastric catheterburun-mide dalgısı
nazone konuşmarhinolaliagenizden konuşma, hımhım konuşma
NCDnoncommunicable diseasebulaşıcı olmayan hastalık, bulaşıcı olmayan sayrılık
near drowningnear drowningboğulayazma
near faintingnear faintingbayılayazma
near syncopenear syncopebayılayazma
nebulafobinebulaphobiasis korkusu
nebulizatörnebulizersisleştirici
nedbecicatrixyara izi
nefrektomi nephrectomyböbrek çıkartımı
nefritnephritisböbrek yangısı
nefro- nephro-böbrek ör. nefrotoksik
nefrolitiyaz(is)nephrolithiasisböbrek taşı sayrılığı
nefrolitotripsinephrolithotripsyböbrek taşı kırımı
nefrolojinephrologyböbrek bilimi
nefronnephronböbrekbirim
nefropatinephropathyböbrek sayrılığı
nefroskopnephroscopeböbrek göreci
nefrostominephrostomyböbrek ağızlaştırması
nefrotoksiknephrotoxicböbrek ağular, böbreğe zararlı
negatifnegative1.eksi 2.olumsuz 3. yok
negatif belirtilernegative symptomseksi belirtiler
negatif dromotropiknegative dromotropiciletimyavaşlatır
negatif geribildirimnegative feedbackkontrol geribildirimi
negatif kronotropiknegative chronotropichızyavaşlatır
negativizmnegativismolmazcılık
negatoskopnegatoscope filmgöreç
neglectneglectihmal
neglected çocukneglected childilgiden yoksun çocuk
nekro- necro-ölü ör. nekroz, nekropsi
nekrofilinecrophiliaölü sevicilik
nekropsinecropsyölü açımı
nekroznecrosisdokuölüm
nematotnematode, roundwormyuvarlak solucan
neo- neo-yeni ör. neonatoloji
neoadjuvan terapineoadjuvant therapykanser ön sağaltımı
neofobineophobiayenilik korkusu
neogenezneogenesisyeni doku oluşumu
neointimaneointimayeni oluşan damar iç katmanı.
neolojizmneologismsözcük uydurma
neonatalneonatalyenidoğan (ilişkili)
neonatolojineonatologyyenidoğan bilimi
neonatolojistneonatologistyenidoğan uzmanı
neoplazineoplasiaur gelişimi
neoplazikneoplasticur gelişik
neovaskülarizasyonneovascularizationyeni damarlanma
nervusnervussinir
nevr(o)- nerve-sinir ör. nevralji
nevraljineuralgiasinir ağrısı
nevrastenineurastheniasüregen yorgunluk belirgesi
nevrozneurosiskaygı bozukluğu
nevüsnevusben
NGnasogastricnazogastrik, burun-mide
NHLnon-Hodgkin lymphomanon-Hodgkin lenfoma, Hodgkin dışı akkan bez uru
NIMVnoninvasive mechanical ventilationnoninvaziv mekanik ventilasyon, girişimsel olmayan mekanik solutma
NIRSnear infrared spectroscopyyakın kızılötesi izgesel görüntüleme
nidusnidusyuva
night terrorpavor nocturnus, night terrorgece terörü
nihilistik delüzyonnihilistic delusionhiçlik sanrısı
niktalopinyctalopia gece körlüğü, tavuk karası
niktofobinyctophobiagece korkusu
niktürinycturiagece idrara çıkma
NİMnoninvasive monitoringnoninvaziv monitorizasyon, girişimsel olmayan izleçleme
nistagmusnystagmustitrek göz
nişnicheoyuk
nitrojennitrogenazot
NİVnoninvasive ventilationnoninvaziv ventilasyon, girişimsel olmayan solutma
NJ tüpnasojejunal tubeburun- boşbağırsak dalgısı
NKnatural killer cellsdoğal öldürücü hücreler
NMESneuromuscular electrical stimulationnöromüsküler elektriksel stimülasyon, sinir-kas elektriksel uyarımı
NMR nuclear magnetic resonancenükleer manyetik rezonans
NOnitric oxidenitrik oksit
NOACnon-vitamin K antagonist oral anticoagulantvitamin K antagonisti olmayan oral antikoagulan, vitamin K karşıt etkin olmayan oral antikoagulan
nodnodedüğüm
nodülnoduledüğümcük
noezisnoesisdüşünme
nokt- noct-gece ör. noktüri
noktürinocturiagece idrara çıkma
noktürnalnocturnalgeceye ilişkin
noktürnal panik atağınocturnal panic attackgece panik atağı
nomenklatürnomenclatureterimlendirme
-nomi-nomidüzen ör. otonom sinir sistemi
nominal afazinominal aphasiaadlandırma yitimi
nomogramnomogramçizit
non- non-olmama ör. noninvaziv
nonbizar delüzyonnonbizzare delusionsaçma olmayan sanrı
non-Hodgkin lenfomanon-Hodgkin lymphomaHodgkin dışı akkan bez uru
noninvazivnoninvasivegirişimsel olmayan
noninvaziv monitorizasyonnoninvasive monitoringgirişimsel olmayan izleçleme
noniskemik dilate kardiyomiyopatinonischemic dilated cardiomyopathyyetersiz kanlanmayla ilişkisiz genişlemiş yürek kas sayrılığı
nonkomünikan noncommunicatingbağlantısız
non-REM uykunon- REM sleepREM dışı uyku
nonspesifiknonspecificözgül olmayan
nonverbal iletişimnonverbal communicationsözsüz iletişim
nonwovennonwovendokunmamış
normnormdüze
normo- norm-normal ör. normositer, normotansif
normoaktifnormoactiveolağan etkinlikte
normoselülernormocellularolağan gözeli
normotansifnormotensivenormal kan basıncı (ilişkili)
normotoniknormotonic1.olağan derişimli 2.olağan gergili
nosiseptörnociceptorağrı almacı
nozo-noso-sayrılık (ilişkili) ör. nozoloji
nozokomiyalnosocomialhastane kaynaklı
nozolojinosologysayrılık sınıflandırma bilimi
nöralneuralsinirsel
nöro- neuro-sinir ör. nöropati
nörofizyolojineurophysiologysinir işlev bilimi
nörogenezneurogenesissinir göze gelişimi
nörogeribildirimneurofeedbacksinir geribildirimi
nörojenikneurogenicsinir kaynaklı
nörokondüksiyonneural conductionsinir ileti
nörokütan sendromneurocutaneous syndromegöz-deri-sinir belirgesi
nöroleptik malign sendromneuroleptic malignant syndromekötücül nöroleptik belirge
nörolizneurolysis1. sinir serbestleşmesi 2. sinir yıkımı
nörolojineurologysinir bilimi
nöromüskülerneuromuscularsinir-kas
nöronalneuronalsinir gözesel
nöropatineuropathysinir sayrılığı
nöroplastisiteneuroplasticitybeyin uyarlanması
nöropraksineuropraxiageçici sinir ileti kesintisi
nöroşirürjineurosurgerybeyin-omurilik-sinir cerrahisi
nörotimezisneurotmesissinir kesilmesi
nörotoksikneurotoxicsinir ağular
nörotransmisyonneurotransmissionaşırtmalı sinir ileti
nörotransmiterneurotransmitterkimyasal sinir ulağı
nötrneuter1.etkisiz 2.yüksüz 3.yansız
nötr- neutr-tarafsız, yönelimsiz ör. nötrofil
nötralizasyonneutralization1. yüksüzleştirme 2.etkisizleştirme
nötrofilneutrophilbozyuvar
nötrofilineutrophiliabozyuvar artışı
NPHneutral protamine Hagendorn insulinnötral protamin Hagendorn insülin
NSAIDnonsteroidal antiinflamatory drugnonsteroit antienflamatuvar ilaç, steroit olmayan yangıgiderir ilaç
NSAİİnonsteroidal anti-inflamatory drugnonsteroit antienflamatuvar ilaç, steroit olmayan yangıgiderir ilaç
NSTnonstress testnonstres test
NSTEnon-ST-segment elevationST segment elevasyonsuz, ST segment yükselmesiz
NSTE-ACSnon-ST-segment elevation acute coronary syndromesST segment elevasyonsuz akut koroner sendrom, ST segment yükselmesiz ivegen taçdamar belirgesi
NSTEMInon-ST-segment elevation myocardial infarctionST segment elevasyonsuz miyokart enfarktüsü, ST segment yükselmesiz yürek krizi
nukalnuchalense (ilişkili)
nuliparnulliparousdoğurmamış
nuliparitenulliparitydoğurmamışlık
numunesampleörnek
nükleik asitnucleic acidçekirdek asidi
nükleo- nucleo-çekirdek ör.nükleotit
nükleolnucleolçekirdekçik
nükleotitnucleotideçekirdek yapı taşı
nükleusnucleusçekirdek
nüksrecurrenceyinelenme
nütrisyonnutritionbeslenme
nüvenucleusçekirdek
NYHANew York Heart AssociationNew York Kalp Derneği
OAosteoarthritisosteoartrit
OAAevent tree analysisolay ağacı analizi, olay ağacı incelemesi
obezobeseşişman
obeziteobesityşişmanlık
objeobjectnesne
obje sürekliliğiobject permanencenesne sürekliliği
objektifobjective1. nesnel 2. mercek düzeneği
oblik eksenoblique axiseğik eksen
obliterasyonobliterationtam kapanma
oblitereobliterated kapanmış
observer biasobserver biasgözlemci yanlılığı
obsesif-kompülsif bozuklukobsessive-compulsive disordertakıntı-zorlantı bozukluğu
obsesif-kompülsif kişilik bozukluğuobsessive-compulsive personality disordertakıntılı-zorlantılı kişilik bozukluğu
obsesyonobsessiontakıntı
obsesyonel dürtüobsessional drivetakıntılı dürtü
obsesyonel düşünceobsessional thoughttakıntılı düşünce
obsesyonel fobiobsessional phobiatakıntılı korku
obsesyonel kıskançlıkobsessional jealousytakıntılı kıskançlık
obstetrikobstetricgebelik-doğum-lohusalık (ilişkili)
obstrüksiyonobstructiontıkanma
obstrüktifobstructivetıkayıcı
obstrüktif uyku apne sendromuobstructive sleep apnea syndrometıkayıcı uyku-soluk durması belirgesi
obzervasyonobservationgözlem
occupational diseaseoccupational diseasemeslek hastalığı
OCToptic coherence tomographyoptik koherens tomografi, görme eşevreli kesitçekim
odds ratioodds ratiogöreli oran
odin- odyn-, painağrı ör. odinofaji
odinofajiodynophagiaağrılı yutma
oditoryumauditoriumtoplantı salonu
odont- odont-diş (ilişkili) ör. odontalji
odontalji odontalgia diş ağrısı
odyo- audio-işitme ör. odyogram
odyogramaudiogramişitme çizgesi
off-pump cerrahioff-pump surgeryatan yürekte cerrahi
ofidiyofobiophidiophobiayılan korkusu
oftalmik ophthalmicgöz (ilişkili)
oftalmo- ophtalmo-göz ör. oftalmopleji
oftalmoplejiopthalmoplegiagöz felci
oftalmoskop ophtalmoscopegöz içi göreci
OHCAout of hospital cardiac arresthastane dışı yürek durması
OİERHautoimmune inflammatory rheumatic diseaseotoimmün enflamatuvar romatizmal hastalık
-oit-oidbenzer, -imsi ör. elipsoit, karsinoit
OKBobsessive-compulsive disorderobsesif-kompülsif bozukluk, takıntı-zorlantı bozukluğu
OKKBobsessive-compulsive personality disorderobsesif-kompülsif kişilik bozukluğu, takıntılı-zorlantılı kişilik bozukluğu
oklüderoccluderyapay tıkaç
oklüzivocclusivetıkayıcı
oklüzyonocclusiontıkanma
oksi-ox(i)-oksijen (ilişkili) ör. oksimetre
oksi-oxy-oksijenlenmiş ör. oksihemoglobin
oksidanoxidantoksitleyici
oksidasyonoxidation1.oksitlenme 2.yükseltgenme
oksidatifoxidativeoksitleyen
oksijenatöroxygenatoroksijenlendirici
oksijenizasyonoxygenationoksijenlenme
oksimetreoxymeteroksijenölçer
oksimetrioximetryoksijen ölçümü
oksipitaloccipitalkafatası arka bölümü
oksipito-occipito-başın arka bölümü ör. oksipitotemporal
oksiputocciputartkafa
oksisefalioxycephalykule kafalılık
oksisefalikoxycephalickule kafalı
oksiyürpinwormkılkurt
OKToptic coherence tomographyoptik koherens tomografi, görme eşevreli kesitçekim
okta- octa-sekiz ör. oktagen
oküleroculargöz (ilişkili)
okülo- oculo-göz ör. okülomotor
okülojirik krizoculogyric crisisbakış sabitlenmesi
oküloplejioculoplegiagöz felci
olaya bağlı potansiyelevent related potentialolaya bağlı gizil güç
olecranon fossaolecranon fossadirsek çukuru
olekranonolecranondirsek çıkıntısı
oleo- oleo-yağ (ilişkili) ör. oleometri
olfaktofobiolfactophobiakoku korkusu
olfaktör halüsinasyonolfactory hallucinationkoku varsanısı
olfaktör referans sanrısıolfactory reference delusionkötü koku salma sanrısı
olfaktör sinirolfactory nervekoku siniri
oligo- oligo-az, az sayıda, yetersiz ör. oligodaktili, oligofreni
oligospermioligospermiergöze azlığı
oligürioliguriaidrar azalması
-oloji-ologybilim dalı ör. kardiyoloji
-oma-omaiyicil ur ör. hepatoma
omentumomentumkarın içi örtüsü
omfalitomphalitisgöbek yangısı
omfalo-omphalo-göbek ör. omfalit
omni-omni-tüm, hepsi ör. omnipotan, omnipotent
omnipotanomnipotenttümgüçlü
omnipotansomnipotencytümgüçlülük
omo- omo-omuz ör. omohiyoid
ondülanundulantdüzenli dalgalı
ondülan ateş undulant feverdalgalı ateş
ondülasyonundulationdüzenli dalgalanım
oniko- onycho-tırnak (ilişkili) ör. onikomikoz
onikomikozonychomycosistırnak mantarı
onko- onco-tümör (ilişkili) ör. onkojen
onkogenezoncogenesiskanser oluşumu
onkojenoncogenouskanser oluşturan
onkologoncologistkanser bilimi uzmanı
onkolojioncologyur bilimi, kanser bilimi
on-pump cerrahion-pump surgerypompa bağlantılı yürek cerrahisi
ontolojiontologyvarlık bilimi
oo- oo-yumurta, ovül ör. oosit
oosit oocyteyumurta gözesi
op.operationameliyat
opakopaqueışıkgeçirmez
opasiteopacityışıkgeçirmezlik
operabloperableameliyatedilebilir
operan şartlanmaoperant conditioningedimsel koşullanma
operasyonoperation1.ameliyat 2.işlem
operatörsurgeoncerrah
opistotonusopisthotonusyaysı kasılma
opiyoitopioidafyonumsu
opiyumopiumafyon
oportünistopportunistfırsatçı
oportünistik enfeksiyonopportunistic infectionfırsatçı bulaş
oportünizmopportunismfırsatçılık
oppozisyonel davranım bozukluğuoppositional defiant disorderkarşıt olma-karşıt gelme bozukluğu
opsiyoneloptional1.seçimlik 2.isteğe bağlı
opti- opti-görme ör. optikosiliyer
optik optic göz veya görme (ilişkili)
optik diskoptic diskkör nokta
optik papillaoptic papillakör nokta
optimaloptimalen uygun
optimizmoptimismiyimserlik
optimumoptimumen uygun
OPVoral polio vaccineoral poliyo aşısı, ağızdan çocuk felci aşısı
ORodds ratioodds ratio, göreli oran
-or (-ör)-oryapan ör. fleksör
oraloralağızdan
orbitaorbit göz çukuru
orbitalorbitalgöz çukuru (ilişkili)
orbito- orbito- göz çukuru ör. orbitonazal
ordırorderhekim istemi
organ harvestingorgan harvestingnakil için organ elde etme
organ procurementorgan procurementnakil için organ alımı
organizasyonorganization1. düzenleme 2. yapılanma 3. örgüt
organizatörorganizerdüzenleyici
organizeorganized1. düzenlenmiş 2. yapılanmış
organizmaorganismcanlı varlık
organomegaliorganomegalyorgan büyüklüğü
orgazmorgasmdoruk doyum
orifisorifice, ostiumaçıklık, ağız
orijinoriginköken
orijinaloriginal1.özgün 2.asıl 3. ilk
orikül(o)-auriculo-1. kulak kepçesi ör. oriküloplasti, 2. kulak kepçesine benzeyen ör. oriküloatriyal
orikülaauricle1. kulak kepçesi 2. kulakçık ön ucu
ornitofobiornithophobiakuş korkusu
orofarenksoropharynxortayutak
ORSoral rehydration solutionoral rehidratasyon sıvısı, ağızdan rehidratasyon çözeltisi
orşi(d)- orchi-erbezine ilişkin ör. orşiyektomi
orşidektomiorchidectomyerbezi çıkartımı
orşiyektomiorchiectomyerbezi çıkartımı
ortalama arter basıncımean arterial pressureortalama atardamar basıncı
orto- ortho-doğru, düzgün ör. ortostatik, ortodromik
ortodromikorthodromicnormal yöne iletir
ortopneortopneadik durumda soluk rahatlığı
ortostatikorthostaticayakta
ortostatik hipotansiyonorthostatic hypotensionayakta kan basıncı düşüklüğü
oryantasyonorientation1. uyum 2. yönelim
-oryum-oriumyer ör. ovaryum
os bonekemik
OSASobstructive sleep apnea syndromeobstrüktif uyku apne sendromu, tıkayıcı uyku-soluk durması belirgesi
osifikasyonossificationkemikleşme
osilasyonoscillationsalınım
osilometrioscillometryelektrik sinyal ölçümü
osiloskoposcilloscopeelektrik sinyal göreci
oskültasyonauscultationdinleme
osmofobiosmophobiakoku tiksintisi
osseözosseouskemiksi
osteo-osteo-kemik ör. osteotomi
osteoartritosteoarthritiskemik-eklem yangısı
osteofitosteophytekemik çıkıntı
osteogenezosteogenesis1. kemik oluşumu 2.kemik gelişimi
osteogenezis imperfektaosteogenesis imperfectacam kemik hastalığı
osteoitosteoidkemiksi
osteojenikosteogenickemikleştiren
osteokondritis dissekansosteochondritis dissecanseklem faresi
osteolizosteolysiskemik yıkımı
osteolojiosteologykemik bilimi
osteomalaziosteomalaciakemik yumuşaması
osteomiyelitosteomyelitiskemik yangısı
osteopeniosteopeniakemik zayıflığı
osteopetroz(is)osteopetrosismermer kemik hastalığı
osteoplastiosteoplastykemik onarımı
osteoporozosteoporosiskemik erimesi
osteosentezosteosynthesiskırık kemik birleştirme
osteosklerozosteosclerosiskemik sertleşimi
osteotomiosteotomykemik kesisi
ostiyumostium, orificeaçıklık
OTCover-the-counter drugstezgâh üstü ilaç, rafüstü ilaç
otistikautistic dışa kapanık
otistik çocukautistic childdışa kapanık çocuk
otizmautismdışa kapanım
oto-auto-kendi, kendine, kendinden ör. otoregülasyon, otoimmünizasyon, otohemoliz
otoampütasyonautoamputationkendinden kopuş
otoantijenautoantigenkendinden antijen
otoantikorautoantibodykendine antikor
otobiyografik hafızaautobiographical memoryyaşamöyküsel bellek
otoenflamasyonautoinflamationkendine yangı
otofajiautophagiakendini yutum
otofobiautophobiayalnızlık korkusu
otogreftautograftkendinden yama
otohemolizautohemolysiskendi alyuvar yıkımı
otoimmünautoimmunekendine yaban
otoimmüniteautoimmunitykendine yabanlık
otoklavautoclavebasınçlı mikropkıran kazan
otolarengolojiotolaryngologykulak-boğaz bilimi
otologautologouskendinden
otomasyonautomationöz işleme
otomatikautomaticözişler
otomatizmautomatismözişlerlik
otonomautonomousözerk
otonom sinir sistemiautonomic nervous systemözerk sinir sistemi
otopsiautopsyölü açımı
otorajiotorrhagiakulak kanaması
otoregülasyonautoregulationöz düzenlenim
otorinolarengolojiotorhinolaryngologykulak-burun-boğaz bilimi
otoriteauthority1.yetkili 2.uzman
otosklerozotosclerosiskulak kireçlenmesi
otoskopotoscopedışkulak yolu göreci
otoskopiotoscopydışkulak yolu göreçleme
otoskopik halüsinasyonautoscopic hallucinationayna hayali varsanısı
ototoksikototoxicişitme siniri ağular
ototransfüzyon autotransfusionkendine kan aktarımı
otozomautosomebeden kromozomları
otozomalautosomalbeden kromozomu (ilişkili)
outflowoutflowdışa akış
outletoutletçıkım
outputoutput1. çıktı 2. debi
ovaryumovary, ovarium yumurtalık
overovary, ovariumyumurtalık
ovi(ü)--oviyumurta ör. ovülasyon
ovo(a)--ovoyumurta ör. ovoit
ovoitovoidyumurtamsı
ovumovumyumurta
ovülovuledölyolu fitili
ovülasyonovulationyumurtlama
ovülasyon indüksiyonuovulation inductionyumurtlama uyartımı
oynaksynovial jointoynar eklem
-oz-osekarbonhidrat bileşiği ör. glikoz
-oz(is)-osissayrılık, sıradışı artış ör. tüberküloz, siyanoz
ozenaozenairinli nezle
-ozmi-osmiakoku ör. anozmi
ozmo-osmo-1. koku ör. ozmofobi 2. ozmoz ör. ozmotik
ozmolariteosmolaritygeçişimlik
ozmometreosmometergeçişimölçer
ozmotikosmoticgeçişimli
ozmotik frajiliteosmotic fragilitygeçişim kırılganlığı
ozmozosmosisgeçişim
ozonozoneüç moleküllü oksijen
ö-eu-normal ör. ötiroidi, ökromatik
ÖÇBanterior cruciate ligamentanterior çapraz bağ, diz ön çapraz bağı
ödemedemaşişlik
öforieuphoriacoşu
ökaryoteukaryoteçekirdekli
ötanazieuthanasiaölme hakkı
ötimieuthymiadengeli duygu durumu
-öz-eusehenüz oluşmamış ör. osseöz
özofagealeusophagealyemek borusu (ilişkili)
özofago-eusophago-yemek borusu ör. özofagoplasti
özofagogastroduodenoskopesophagogastroduodenoscopeyemek borusu-mide-onikiparmak bağırsak göreci
özofagogastroduodenoskopiesophagogastroduodenoscopyyemek borusu-mide-onikiparmak bağırsak göreçleme
özofagoplastiesophagoplastyyemek borusu onarımı
özofagoskopesophagoscopeyemek borusu göreci
özofagoskopiesophagoscopyyemek borusu göreçleme
özofagusesophagusyemek borusu
p.c.post cibum, after meals yemekten sonra
p.o.oralper os, ağızdan
PApulmonary arterypulmoner arter, akciğer atardamarı
PABpulmonary artery pressurepulmoner arter basıncı, akciğer atardamar basıncı
pacemakerpacemakeryürek pili
pacingpacinguyarı oluşturma (yürek pili)
PACSpicture archiving and communication systemsgörüntü arşivleme ve iletişim sistemleri, görüntü saklama ve iletişim sistemleri
PADperipheral artery diseaseperiferik arter hastalığı, çevresel atardamar hastalığı
PAFplatelet activating factortrombosit aktifleştirici faktör, pulyuvar etkinleştirici etken
PAH1.peripheral artery disease 2. pulmonary artery hypertension1.periferik arter hastalığı, çevresel atardamar sayrılığı 2. pulmoner arter hipertansiyonu, akciğer atardamar yüksek basıncı
paki-pachy-kalın ör. pakiplörit
pakimeninkspachymeninxbeyin-omurilik sert zarı
pakimetrepachymeterkalınlıkölçer (kornea)
pakimetripachymetrykalınlık ölçüm (kornea)
palatinpalatinedamak (kemik)
palato- palato-damak ör. palatoglossal
palatumpalatedamak
pali- pali-tekrar, geri dönüş ör. palilali
palilalipalilaliabozuk plak konuşması
palm- palm-el ayası ör. palmar
palmarpalmarel ayası (ilişkili)
palmar reflekspalmar reflexkavrama tepkesi
palpabılpalpableelegelir
palpasyonpalpationelle inceleme, elle yoklama
palpitasyonpalpitation1.çarpıntı duygusu 2.helecan
palsipalsyfelç
palyasyonpalliation1.hafifletme, 2.azaltma
palyatif palliative rahatlatıcı
palyatif tedavipalliative treatmentrahatlatıcı sağaltım
PANperiarteritis nodosa, polyarteritis nodosaperiarteritis nodoza, poliarteritis nodoza
pan- pan-bütün, hepsi ör. pansitopeni
panarispanarisdolama
panarteritpanarteritisatardamar tüm katman yangısı
pançpunchdeşal
pandemipandemiaküresel salgın
pandiyastolikpandiastolicdiyastolü dolduran
panfobipanphobiaherşeyden korkma
pankarditpancarditisyürek katmanları yangısı
pankreatitpancreatitispankreas yangısı
pankreato- pancreato-pankreas (ilişkili) ör. pankteatolitik
pansistolikpansystolicsistolü dolduran
pansitopenipancytopeniatüm kan göze azlığı
pansumandressingyara bakımı
panto- panto- bütün, hepsi ör. pantotropik
panzehirantidoteağugiderir
PAP1.       pulmonary artery pressure1.       pulmoner arter basıncı, akciğer atardamar basıncı
2.       positive airway pressure2.       pozitif havayolu basıncı
Pap testPap test, Pap smeardölyatağı ağzı sürüntüsü
papillapapillameme ucu biçiminde kabarıklık
PAPRpowered air-purifying respiratorelektrikli hava temizleyici solunum cihazı
-par-pargebelik sayısı ör. primipar
para- para-yanında, çevresinde, ör. paraaortik
paraaortikparaaorticaort yanı
paradoksparadoxçelişki
paradoksalparadoxicalçelişkili
parafaziparaphasiasözcük bulma güçlüğü
parafiliparaphiliacinsel sapkınlık
parafraziparaphrasiadil sürçmesi
paragrafiparagraphyyazılı anlatım güçlüğü
parakrinparacrineyerel hormon
paralaliparalaliaharf söyleyiş güçlüğü
paralitikparalyticfelçli
paraliziparalysisfelç
paralojiparalogiayanlış akıl yürütme
paramedikalparamedicaltıpla bağlantılı
paramediyanparamedianortaya yakın
parametreparameterdeğişken
paramneziparamnesiabellek yanılsaması
paranazalparanasalburun yanı
parankimparenchymaözek doku
paranoit bozuklukparanoid disordersanrısal bozukluk
paranoit kişilik bozukluğuparanoid personality disorderkuşkucu kişilik bozukluğu
paranoya paranoiaakıl dışı saplantı
paraparezi paraparesisaltyarı hafif felci
parapleji paraplegiaaltyarı tam felci
parapraksiparapraxiadil-devinim sürçmesi
parapsikolojiparapsychologyruh bilim ötesi
parasentezparacentesiskarın zarı sıvı alımı
parasternalparasternalgöğüs kemiği yanı
parasuisitparasuicideözkıyım girişimi
paravertebralparavertebralomurga yanı
parazit parasite1. asalak 2. karışıntı
parazitolojiparasitologyasalak bilimi
parenteralparenteralsindirim yolu dışı
parenteral nütrisyonparenteral nutritionsindirim yolu dışı beslenme
paresteziparesthesiaduyu yanılsaması
pareziparesishafif felç
-parezi-parasiahafif felç ör. paraparezi
pariyetalparietal1. duvar kemiği (ilişkili) 2. duvar (organ veya boşluk).
pariyetal kemikparietal boneduvar kemiği (kafa)
Parkinson triyadıParkinson triadParkinson üçlüsü
parmak agnozisifinger agnosiaparmak tanımazlık
paroksismalparoxysmalnöbetlemeli
paroksismal supraventriküler taşikardiparoxysmal supraventricular tachycardianöbetlemeli hızlı karıncık üstü vurusu
paronişiparonychia, felon, whitlowdolama
parosmiparosmiakoku algısı bozukluğu
parotisparotidkulak altı tükürük bezi
parsiyelpartialkısmi
partikülparticleparçacık
part-timepart-timeyarı zamanlı
pasajpassage1.geçiş 2.geçit
pasifpassiveedilgen
pasif ötanazipassive euthanasiaedilgen ölme hakkı
pasif-agresif passive-aggressive edilgen-saldırgan
pasif-agresif tutumpassive aggressive attitudeedilgen-saldırgan tutum
PATparoxysmal atrial tachycardiaparoksismal atriyal taşikardi, nöbetlemeli hızlı kulakçık vurusu
-pat-pathhastalık ör. psikopat
pat-path-hastalık, sayrılık ör. patofobi
patch patchyamalık
patchplastypatchplastyyamalama
patellapatelladiz kapağı (kemiği)
patella refleksipatella reflexdiz tepkesi
patenspatencyaçık kalma
patent.patent 1.açık 2. buluş belgesi
paternpattern1.örüntü 2.kalıp
patern analizpattern analysisörüntü çözümleme
paternalpaternalbabadan
-pati-pathy1.sayrılık ör. retinopati 2. duyum, sezgi ör. telepati
patofizyolojipathophysiologysayrılık oluşum bilimi
patofobipathophobiahastalanma korkusu
patogenezpathogenesissayrılık gelişim süreci
patognomikpathognomonictanı koydurucu
patojenpathogenhastalık yapıcı, sayrılayıcı
patojenikpathogenicyozlatan, sayrılayan
patolojipathologysayrılık bilimi
patolojikpathologicsayrılık (ilişkili)
pavor noktürnüspavor nocturnusgece terörü
PCIpercutaneous coronary interventionperkütan koroner girişim, deriden taç atardamar girişimi
PCLposterior cruciate ligamentposterior çapraz bağ, diz arka çapraz bağı
pCO₂partial carbon dioxide pressureparsiyel karbondioksit basıncı
PCOSpolycystic ovary syndrome polikistik over sendromu, çok keseli yumurtalık belirgesi
PCRpolymerase chain reactionpolimeraz zincir tepkimesi
PDperitoneal dialysisperiton diyalizi, karın zarından arıtım
PDApatent ductus arteriosuspatent duktus arteriyozus, duktus arteriyozus açıklığı
PD-AVRrapid deployment aortic valve replacementhızlı yerleşen aort kapak değişimi
PDÖproblem-based teachingprobleme dayalı öğretim
PEpulmonary embolismpulmoner emboli, akciğer damar tıkanımı
ped(i)(o)-ped(i)(o)-1. ayak ör. pedikül 2. çocuk ör. pediyatri
-pedal-pedalyaklaşan ör. santripedal
pedigri pedigreesoyağacı
pedikülpedicle1.ayak, ayakçık 2.sap
pedikülozpediculosisbitlenme
pediyatripediatricsçocuk sağlığı ve hastalıkları bilimi
pediyatrikpediatricçocuk (ilişkili)
pediyatrist pediatristçocuk hekimi
pedofilipedophiliaçocuk sevicilik
pedünkül pedinclesap
peelingpeelingderi soyma
PEFmetrepeak flow metertepe akım hızıölçer
PEGpercutaneous endoscopic gastrostomyperkütan endoskopik gastrostomi, deriden iç göreçlemeyle mide ağızlaştırması
-peksi-pexyaskılama ör. rektopeksi
pektinet kaspectinate muscletaraksı kas
pektoralpectoralis, pectoralgöğse ait
pektuspectusgöğüs, döş
pektus ekskavatumpectus excavatumkunduracı göğsü
pektus karinatumpectus carinatumgüvercin göğsü
pelatalopecia areatasaçkıran
pellegrapellegraberiberi hastalığı
pelvikpelvicleğen bölgesi (ilişkili)
pelvispelvisleğen kemiği
pendantpendantaskı
penetranpenetrant1. delici 2. içegeçen
penetran yaralanma penetrating injurydelici yaralanma
penetranspenetranceiçe geçiş, içe işleme
penetrasyonpenetration1. delme 2. içe geçme
-peni-peniaazlık, eksiklik, yoksunluk ör. trombositopeni
penispeniserkeklik organı
pensetforcepstutçek
penta-penta-beş ör. pentaloji
pentalojipentalogybeşlik
pentozpentosebeş karbonlu karbonhidrat
penumbrapenumbrayarı gölgeleme
peptikpepticsindirimsel
per-per- yoluyla ör. perkütan
per oral oralağızdan
per os oralağızdan
perakutperacuteaşırı ivegen
perfeksiyonizmperfectionismmükemmelliyetçilik
perforanperforantdelici
perforasyonperforationdelinme
perforatör damarperforator vesseldelici damar
performansperformance1. verim 2. başarım 3. gösteri
perfüzörperfusorkana sıvı aktarıcı, sıvı pompası
perfüzyonperfusion1. kanlanma 2. kana sıvı aktarımı
perianalperianalbüzük çevresi
periarteritperiarteritisatardamar çevresi yangısı
periferikperipheralçevresel
periferik yaymaperipheral blood smearçevresel kan yayması
perikarditpericarditisyürek zar yangısı
perikardiyalpericardialyürek zarı (ilişkili)
perikardiyektomipericardiectomyyürek zar çıkartımı
perikardiyosentezpericardiocentesisyürek zar sıvı alımı
perikardiyotomipericardiotomyyürek zar açımı
perikartpericardiumyürek zarı
perikondriumperichondriumkıkırdak zarı
perimetriyumperimetriumdölyatağı dış katmanı
perinatalperinataldoğum süreci
perineperineumapışarası
perioperatifperioperativeameliyat süreci
perioralperioralağız çevresi
periorbitalperiorbitalgöz çevresi
peripartumperipartumdoğum dönemi
peripartum kardiyomiyopatiperipartum cardiomyopathydoğum dönemi yürek kas sayrılığı
peristaltikperistalticsağınımlı
peritonperitoneumkarın zarı
periton diyaliziperitoneal dialysiskarın zarından arıtım
periton sıvısıperitoneal fluidkarın zarı sıvısı
peritonealperitonealkarın zarı (ilişkili)
peritonitperitonitiskarın zarı yangısı
perivaskülerperivasculardamar çevresi
periyodikperiodic, periodical1. dönemsel 2. süreli (yayın)
periyostperiosteumkemik zarı
periyotperioddönem, devre
perküsyonpercussiontıptıplama
perkütanpercutaneousderi yoluyla, deriden
perkütan nefrolitotripsipercutaneous nephrolithotripsyderiden böbrek taşı kırımı
perkütan nefrostomipercutaneous nephrostomyderiden böbrek ağızlaştırması
permeabilitepermeabilitygeçirgenlik
perpendikülerperpendiculardikey
persantilpercentileyüzdelik
perseküsyon delüzyonudelusion of persecutiondüşmanlık görme sanrısı
persepsiyonperceptionalgılama
perseverasyonperseverationtekrarlı takılım
persistanpersistentinatçı
personalitepersonalitykişilik
perspektifperspectivebakış açısı
perspirasyonperspirationterleme
perspiratuvarperspiratory1.ter (ilişkili) 2.terletici
pervasive developmental disorderpervasive developmental disorderyaygın gelişimsel bozukluk
pes footayak
pes ekinovaruspes equinovarusiçe çarpık at ayağı
pes planuspes planusdüz taban
pes valguspes valgusdışa çarpık ayak
pes varuspes varusiçe çarpık ayak
PETpositron emission tomographypozitron emisyon tomografi, pozitron yayılımlı kesitçekim
PET/BTpositron emission tomography/ computerized tomographypozitron emisyon tomografi/ bilgisayarlı tomografi, pozitron yayılımlı kesitçekim/ bilgisayarlı kesitçekim
peteşipetechianoktasal kanama
petit malpetit maldalma nöbeti
petroz kemikpetrous bonekaya kemiği
PFOpatent foramen ovalepatent foramen ovale, açık foramen ovale
pHpower of hydrogenhidrojen gücü
PhDdoctor of philosophy akademik uzman
pHmetrepower of hydrogenmeterhidrojen gücüölçer
pHmetripower of hydrogenmetryhidrojen gücü ölçümü
PHTpulmonary hypertensionpulmoner hipertansiyon, akciğer damar yüksek basıncı
PIDpelvic inflammatory diseasepelvik enflamatuvar hastalık, leğen bölgesi yangısal sayrılığı
pia materpia materbeyin-omurilik ince zarı
piercingpiercingdeltak
pikpeak1.tepe 2.doruk
pilot çalışmapilot studyöncül çalışma
pinositozpinocytosisgöze sıvı içimi
piriform piriformarmudumsu
piro-pyro- ateş ör. pirojen
pirofobipyrophobiaateş korkusu.
pirojenpirogenateş yükseltici
piromanipyromaniayangın çıkarma saplantısı
pisiform pisiformbezelyemsi
pistonpistonitenek
piterijiyumpterygiumkuşkanadı
pitozptosisorgan düşüklüğü
pityriasis roseapityriasis roseagül hastalığı
piyelo-pyelo-böbrek havuzcuğu ör. piyelonefrit
piyelonefritpyelonephritisböbrek ve havuzcuk yangısı
piyo-pyo-irin ör. piyodermi
piyodermipyodermairinli deri
piyojenikpyogenicirinleştiren
piyotorakspyothoraxgöğüs boşluğu içi irin
piyüripyuriairinli idrar
PKOSpolycystic ovary syndrome polikistik over sendromu, çok keseli yumurtalık belirgesi
plagiyosefaliplagiocephalyyamuk kafalılık
plagiyosefalikplagiocephalicyamuk kafalı
planplanedüzlem
planimetriplanimetrydüzlem ölçümü
plantarplanterayak tabanı (ilişkili)
plaseboplacebosözde ilaç, yalancı ilaç
plasentaplacentadöleşi, etene, son
plasenta previaplacenta previaönde döleşi
-plasti-plastyonarım, biçimlendirme ör. valvüloplasti
-plastik-plasticgelişmiş ör. aplastik
plastisiteplasticityuyumlanabilirlik
platelet plateletpulyuvar
platoplateaudüzlük
plazi plasiagelişme
-plazi-plasiagelişme ör. neoplazi
-plazik-plasticgelişmiş ör. hipoplazik
plazmaplasmakan sıvısı
plazma(o)-plasma-kan sıvısı ör. plazmaferez
plazmaferezplasmapheresiskan sıvısı ayırseç
plazmositplasmocyteantikor salar göze
pledgepledgedestek
plejiplegiafelç
-pleji-plegiafelç ör. hemipleji
pleksusplexussinir-damar ağı
pleo-pleo-çok, fazla ör. pleomorfizm
pleomorfikpleomorphicçok biçimli
pleomorfizmpleomorphismçok biçimlilik
pletorepletorrheaal yüz
plevrapleuraakciğer zarı
plevralpleuralakciğer zarı (ilişkili)
plevral sıvıpleural fluidakciğer zarı sıvısı
plikaplicakatlantı
plikasyonplicationkatlanma
plörezipleurisy, pleuritisakciğer zarı yangısı
plöritpleuritisakciğer zarı yangısı
PMpacemakerpacemaker, yürek pili
PN1. parenteral nutrition 2. periarteritis nodosa 1. parenteral nütrisyon, sindirim yolu dışı beslenme 2. periarteritis nodaza
-pne-pneasoluk, solunum ör. dispne
PNLpercutaneous nephrolithotripsyperkütan nefrolitotripsi, deriden böbrek taşı kırımı
pnömo-pneumo-1. hava (ilişkili) ör. pnömotoraks 2. akciğer (ilişkili) ör. pnömoni
pnömonektomipneumonectomyakciğer çıkartımı
pnömonipneumoniaakciğer yangısı
pnömoperitonpneumoperitoneumkarın zarı içi hava birikimi
pnömotikpneumatichavalı, hava basınçlı
pnömotorakspneumothoraxgöğüs boşluğu içi hava birikimi
PNSperipheral nervous systemçevresel sinir sistemi
POoralper oral, ağızdan
pO₂partial oxygen pressureparsiyel oksijen basıncı
podo-podo- ayak ör. podoloji
poikilo-poikilo-çok biçimli ör. poikilositoz
poikilositozpoikilocytosisçok biçimli alyuvar
polaritepolaritykutupluluk
polarizasyonpolarizationkutuplaşma
polenpollençiçek tozu
poli-poli-çok, fazla ör. poliüri
polidaktilipolydactylyfazla parmaklılık
polidipsipolydipsiaaşırı susama
polifajipolyphagiaaşırı yeme
poliformpolyformçok biçimli
poligenikpolygenicçok genli
polikistikpolycysticçok keseli
polikromazipolychromasia1. çok renklilik 2. mavimsi alyuvar
polimenorepolymenorrheasıkça âdet
polimerpolymerçoğuz
polimerizasyonpolymerizationçoğuzlama
polimorfpolymorph1.çok biçimli 2.parçalı
polimorfikpolymorphicçok biçimli
polimorfizmpolymorphismçok biçimlilik
polinompolinomçok terimli
polinükleerpolynuclearçok çekirdekli (göze)
polippolypsaplı ur
polipektomipolypectomysaplı ur çıkartımı
polisitemierythrocytosis, polycythemiakanbastı
polisitemia verapolicytemia verakanbastı hastalığı
polisomnografipolysomnographyuyku çizgesi
poliüripolyuriaaşırı işeme
polivalanpolyvalentçok değerlikli
pollaküripollakiuriasık işeme
polleksthumbel başparmağı
pomatpomade, ointmentsıvağ
ponksiyonpunctiondelme
ponsponsbeyin sapı köprüsü
popliteal poplitealdiz ardı çukuru (ilişkili)
popliteus popliteusdiz ardı çukuru
popülasyonpopulation1.topluluk 2.nüfus
porporegözenek
poroziteporositygözeneklilik
portportagiriş yeri
portabılportabletaşınabilir
portalportalkarın ana toplardamarı (ilişkili)
portegüneedle holderiğnetutar
post- post-sonra, izleyen ör. postmortem
posteriorposterior1. arka 2. arkada
posterior krusiyat ligamentposterior cruciate ligamentposterior çapraz bağ, diz arka çapraz bağı
posterior üretral valfposterior urethral valvearka siyek kapağı
postero- postero-arkada ör. posteromediyal
posterolateralposterolateralarka-dışyan
posteromediyalposteromedialarka-içyan
postiktalpostictalnöbet sonrası
postkardiyotomipostcardiotomyyürek açımı sonrası
postmatür bebekpostmature infantsürmatür bebek, geçdoğan
postmortempostmortemölüm sonrası
postnatalpostnataldoğum sonrası
postop.postoperativeameliyat sonrası
postoperatifpostoperativeameliyat sonrası
postpartumpostpartumdoğum sonrası
postprandiyalpostprandialtokluk, öğün sonrası
postsantralpostcentralmerkez sonrası
postterm gebelikpostterm pregnancyuzamış gebelik
posttravmatik stres bozukluğuposttraumatic stress disordertravma sonrası stres bozukluğu
postürposturebeden duruşu
postüral hipotansiyonpostural hypotensionayakta kan basıncı düşüklüğü
potansiyelpotentialgizil güç
potentpotentgüçlü
Pott hastalığımal de Pottomurga veremi
pozisyonposition1.konum 2.durum
pozitifpositive1.varolan 2.artı 3.olumlu
pozitif dromotropikpositive dromotropiciletimhızlandırır
pozitif kronotropikpositive chronotropichızartırır
pozolojiposologydozlama bilgisi
PPpolypropylenepolipropilen
PPDpurified protein derivativesaflaştırılmış protein türevi
PPEpersonal protective equipmentkişisel koruyucu ekipman, kişisel koruyucu donanım
PPİproton pump inhibitorproton pompa inhibitörü, proton pompa engelleyici
PPM1.permanent pacemaker 2. patient prosthesis mismatch1. kalıcı yürek pili 2. hasta-protez kapak uyumsuzluğu
ppoFEVpostoperative predictive forced expiratory volumeameliyat sonrası tahmini zorlu soluk verim hacmi
ppoVO2maxpostoperative predictive maximum oxygen consumption volumeameliyat sonrası tahmini maksimum oksijen tüketimi, ameliyat sonrası tahmini en yüksek oksijen tüketimi
PRpulmonary regurgitationpulmoner regürjitasyonu, pulmoner yetersizlik
pragmatikpragmaticyararcı
praksipraxisedim
prandiyalprandialöğüne ait
pre- pre-ön, önce ör. prediyabet
prediktifpredictiveöngördürücü (etken)
prediktörpredictoröngördürücü
predispozanpredisposingyatkınlaştıran
predispozan faktörpredisposing factoryatkınlaştırıcı etken
predispozepredisposedyatkın
predispozisyonpredispositionyatkınlık
prediyabetprediabetesöncül şeker hastalığı
preejeksiyonpreejectionfırlatma öncesi
preeklampsipreeclampsiaöncül gebelikbastı
preeksitasyonpreexcitationerken uyarılma
preimplantasyonpreimplantationdölyatağı ekimi öncesi
prekapilerprecapillarykılcal damar öncesi
preklinikpreclinicalklinik öncesi
prekordiyalprecordial1. yürek önü 2. mide önü
prekordiyumprecordiumyürek önü bölgesi
prekürsörprecursoröncül
preliminerpreliminary1. öncül 2. ilk
preloadpreloadön yük
prematürepremature1. erkendoğan, günsüz 2. erken
prematüre vuruextrasystoleerken vuru
premedikasyonpremedicationhazırlayıcı sağaltım
premenstrüel disforipremenstrual dysphoriaâdet öncesi bungunluğu
premenstrüel disforik bozuklukpremenstrual dysphoric syndromeâdet öncesi bungunluk belirgesi
premolar dişpremolar toothküçük azı
premorbitpremorbidsayrılık öncesi
prenatalprenataldoğum öncesi
prensipprincipleilke
preop. preoperativeameliyat öncesi
preoperatifpreoperativeameliyat öncesi
preparasyonpreparationhazırlama
preparatpreparatehazır ilaç
prepisyumforeskin, preputiumsünnet derisi
presantralprecentralmerkez öncesi
presipitanprecipitant1.tetikleyici 2.hızlandırıcı 3.çökeltici
presipitan faktörprecipitating factortetikleyici etken
presipitasyonprecipitation1.çökelme, 2.hızlandırma
presistolikpresystolicsistol öncesi
presörpressorkan basıncı yükselten
preterm bebekpreterm infantprematüre bebek, erkendoğan
prevalanprevalentyaygın
prevalansprevalenceyaygınlık oranı
prevantifpreventiveönleyici
prezantasyonpresentationsunum
prezervasyonpreservationkoruma
prezervasyon solüsyonupreservation solutionkoruma çözeltisi (transplantasyon)
prezervatifpreservativebozunumönler
prick testskin prick testderi delme testi
primeprimeöncel
primerprimarybirincil
primer delüzyonprimary delusionbirincil sanrı
primer dikkatprimary attentionbirincil dikkat
primer emosyonprimary emotionbirincil duygu
primer motivasyonprimary motivationbirincil güdü
primer süreç düşünmeprimary process thinkingbirincil süreç düşünme
primer travmaprimary traumabirincil travma
primer zihin yetileriprimary mental abilitiesbirincil zihin yetileri
primingpriminghazırlama
primitifprimitiveilkel
primordiyalprimordial1. ilkel 2.temel
primumprimum1.ilk 2.önce
primum nihil nocereprimum nihil nocereöncelikle zarar verme
primum nil nocereprimum nil nocereöncelikle zarar verme
primum non nocereprimum non nocereöncelikle zarar verme
PRKphotorefractive keratoctomyfotorefraktif kornea kesisi, ışıkkıran saydam tabaka kesisi
pro- pro-ön, önden, önceden ör. profilaksi
probiyotikprobioticyararlı minican
prodromprodromönbelirti
prodromalprodromalönbelirtili
profilprofile1. döküm 2. yandan görünüş
profilaksiprophylaxisönleme
profilaktikprophylacticönleyici
prognatiprognathiaçekmece çene
prognozprognosissonlanım, akıbet
programprogramizlence
progresprogress1. ilerleme 2. günlük
progresifprogressiveilerleyici
progresyonprogressionilerleyiş
projeksiyonprojection1. yansıtma 2. iz düşüm
projektif identifikasyonprojective identificationyansıtmalı özdeşim
projektilprojectilemermi, atış
projektil kusmaprojectile vomitingfışkırır kusma
prokoagülanprocoagulantpıhtılaşma öncüsü
proksimalproximalbaşlangıca yakın
prokt- proct-büzük ve düz bağırsak ör.proktoloji
prokto-procto-makat-düz bağırsak
proktolojiproctologymakat-düz bağırsak bilimi
proktorafiproctorrhaphymakat dikimi
prolapsusprolapsussarkma
proliferasyonproliferationçoğalma
proliferatifproliferativeçoğalan
promotorpromotorkurucu, geliştiren
pronproneyüzüstü
pronasyonpronationiçe dönme (kol vb.)
propprobebaşlık, mil
proporsiyonproportionorantı
proporsiyonelproportionalorantılı
proprioseptifproprioceptivederin duyu
propriyosepsiyonproprioceptionkonum duyusu algılama
propriyoseptörproprioceptorkonum duyusu almacı
prosedürprocedureişlem
prosedürel bellekprocedural memoryişlem belleği
prosensefalonforebrainönbeyin
prosesprocesssüreç
prospektifprospectiveilerleyik
prospektif evalüasyon retrospective evaluationilerleyik değerleme
prospektüspackage inserttanıtmalık
prostatprostateönbez, kestanecik
protagonistprotagonistbenzer etkili
proteazproteaseproteinyıkan (enzim)
protektifprotectivekoruyucu
protezprosthesistakma
proto-proto-1.ilk, baş ör. prototip 2.erken ör. protodiyastol
protodiyastolprotodiastoleerken diyastol
protodiyastolikprotodiastolicerken diyastolik
prototipprototype1. ön model 2. ilk örnek
provokasyonprovocationkışkırtma
provokatifprovocativekışkırtıcı
prozopagnoziprosopagnosiayüz tanımazlığı
PRPplatelet rich plasmapulyuvardan zengin plazma
prurituspruritus kaşıntı
pruritus ani pruritus animakat kaşıntısı
PSAprostate-specific antigen prostat spesiifk antijen, prostata özgül antijen
PSGpolysomnographypolisomnografi, uyku çizgesi
psi(ko)- psych-ruh ör. psikanaliz
psikanalistpychoanalystruhsal çözümleyici
psikanalizpsychoanalysisruhsal çözümleme
psikiyatripsychiatryruh hekimliği
psikiyatristpsychiatristruh hekimi
psikodinamik teoripsychodynamic theoryruhsal çözümleme kuramı
psikodiyagnozpsychodiagnosisruhsal tanılama
psikoeğitimpsychoeducationruhsal eğitim
psikojenikpsychogenicruhsal kaynaklı
psikojenik kaçışpsychogenic fugueruhsal kaçış
psikojenik nöbetpsychogenic seizure ruhsal nöbet
psikoleptikpsycholepticruhsal yatıştırıcı
psikolojipsychologyruh bilimi
psikolojik anormallikpsychological abnormalityruhsal sapma
psikolojik plastisitepsychological plasticityruhsal uyumlanma
psikomotor ajitasyonpsychomotor agitationruhsal-devinimsel kışkırtı
psikomotor bradikinezipsychomotor bradykinesiaruhsal-devinimsel yavaşlama
psikomotor hızlanmapsychomotor accelerationruhsal-devinimsel hızlanma
psikomotor retardasyonpsychomotor retardationruhsal-devinimsel yavaşlama
psikopatpsychopathtoplum karşıtı kişi
psikopatolojipsychopathologyruhsal sayrılık oluşum bilimi
psikoseksüel gelişimpsychosexual developmentruhsal-cinsel gelişim
psikosomatikpsychosomaticruhsal-bedensel
psikosomatik bozuklukpsychosomatic disorderruhsal-bedensel bozukluk
psikososyal gelişim psychosocial development ruhsal-toplumsal gelişim
psikososyal kişilik kuramıpsychosocial personality theoryruhsal-toplumsal kişilik kuramı
psikostimülanpsychostimulantruhsal uyarıcı
psikoterapipsychotherapyruhsal sağaltım
psikotik depresyonpsychotic depressionpsikotik çökkünlük
psikotroppsychotropiczihinetkiler, ruhetkiler
psikozpsychosisgerçeklik yitimi
psişepsyche, soulruh
psişik komplekspsychological complexruhsal karmaşa
psödo- pseudo-yalancı ör. psödohermafroditizm
psödoaglütinasyonpseudoagglutinationyalancı kümeleşme
psödoanevrizmapseudoaneurysmyalancı balonlaşma
psödoartrozpseudoartrosisyalancı eklem
psödodemanspseudodementiayalancı bunama
psödohalüsinasyonpseudohallucinationyalancı varsanı
psödohermafroditizmpseudohermaphroditismyalancı erdişilik
psödointimapseudointimayalancı damar iç katmanı.
psödosiyezispseudocyesisyalancı gebelik
psödotümör serebripseudotumor cerebriiyicil kafa içi basınç artışı
psöriyazispsoriasissedef hastalığı
PSS1. progressive systemic sclerosis 2. peripheral nervous system1. progresif sistemik skleroz, ilerleyici sistemik skleroz 2. periferik sinir sistemi, çevresel sinir sistemi
PSVTparoxysmal supraventricular tachycardiaparoksismal supraventriküler taşikardi, nöbetlemeli hızlı karıncık üstü vurusu
PTprothrombin timeprotrombin zamanı
pterigoitpterygoid, wing shaped kanatsı
PTFEpolytetrafluoroethylenepolitetrafloroetilen
PTZprothrombin timeprotrombin zamanı
PUpeptic ulcuspeptik ülser
pubertepubertyerinlik
pubispubisçatı kemiği
puerperal sepsispuerperal sepsislohusa humması, albastı
pufpufffıs
PUKÖplan, implement, control, actionplan, uygulama, kontrol, önlem
pulmo- pulmo-akciğer ör. pulmoner
pulmonerpulmonaryakciğer
pulmoner dolaşımpulmonary circulationküçük kan dolaşımı, solunumsal dolaşım
pulmoner embolizmpulmonary embolismakciğer damar tıkanımı
pulmoner sirkülasyonpulmonary circulationküçük kan dolaşımı, solunumsal dolaşım
pulmoner stenozpulmonary stenosisakciğer damar darlığı
pulmoner valfpulmonary valvepulmoner kapak
pulmoner valf stenozupulmonary valve stenosispulmoner kapak darlığı
puls oksimetrepulse oximetervuru-oksijenölçer
pulsasyonpulsationvurum
pulsatilpulsatilevurumlu
pulsatil salımpulsatile releasedizemli salım
pulsepulsenabız
pulse deficitpulse deficitnabız farkı
pulsuspulsenabız
pulsus alternanspulsus alternansdeğişimli nabız
punch biyopsipunch biopsydelerek parçaalım
pupillapupillagözbebeği
purgingpurging1.ayıklama 2.arındırma
purging bozukluğupurging disorderyeme-çıkarma bozukluğu
purpurapurpura1.deri-mukoza kanaması 2. deri-mukoza kanama sayrılığı
puşepushing hızla zerk
puvarpoiresıvı çeker-üfler
pusirin
pürgatifpurgativebağırsakboşaltır
pürülanpurulentirinli
püstülpustuleirinli kabarcık
pütrefaksiyonputrefaction1.kokuşma 2.çürüme
PVCpolyvinylchloridepolivinilklorür
PVDApartial venous return anomalyparsiyel venöz dönüş anomalisi, kısmi toplardamar dönüş sapaklığı
PVL paravalvular leakageparavalvüler kaçak, takma kapak kaçağı
PVR 1. pulmonary vascular resistance 2. pulmonary valve replacement1. pulmoner vasküler rezistans, akciğer damar direnci 2. pulmoner valf replasmanı, pulmoner kapak değişimi
PWCPpulmonary wedge capillary pressurepulmoner wedge kapiler basınç, akciğer kılcal damar tıkalı uç basıncı
PY1. pulmonary insufficiency 2. peripheral blood smear1. pulmoner yetersizlik 2. periferik yayma
q.d.every dayher gün
q.h.every hourher saat başı
q.i.dfour times a daygünde dört kez
q.m.every morningher sabah
q.n.every night, quaque nocteher gece
q.n.every nighther gece
q.n.s.quantity not sufficientyeterli miktarda değil
q.p.ad.lib, quantum placeatistendiği kadar
q.q.from each, que queher birinden
q.q.h.every four hoursdört saatte bir
Q.R.quantity right per, quantum rectumdoğru miktarda
q.s.sufficient quantity yeterli miktarda
QALYquality adjusted life yearskaliteye ayarlanmış yaşam yılları
QIDfour times a day, quater in diegünde dört kez
Quincke ödemiQuincke edemakalıtımsal dev şişlik
RA1. radial artery 2. right atrium 3. rheumatoid arthritis1. radiyal atardamar 2. sağ atriyum, sağ kulakçık 3. romatoit artrit
RAAright atrial appendixsağ atriyal apandiks, sağ kulakçık kör eki
RAASrenin-angiotensin-aldosterone systemrenin-angiotensin-aldosterone sistemi
rabdomiyolizrhabdomyolysisçizgili kas yıkımı
rabdomiyomrhabdomyomaiyicil çizgili kas uru
rabdomiyosarkomrhabdomyosarcomakötücül çizgili kas uru
radradiation absorbed doseradyasyon emilim dozu
radi(y)o- radio-ışın ör. radyoloji
radikalradicalkökten
radiksradixsinir kökü
radikülopatiradiculopathysinir kökü sayrısı
radiusradiusdöner kemik
radiyalradial1. ışınsal 2. döner kemik (ilişkili)
radyasyonradiationışınım
radyoaktifradioactiveışın etkin
radyoaktiviteradioactivityışın etkinlik
radyocerrahiradiosurgeryışın cerrahisi
radyografiradiographyX-ışınlı görüntüleme
radyogramradiogramX-ışınlı görüntü
radyolojiradiologyışın bilimi
radyolüsentradiolucentışıngeçirir
radyoopakradiopaqueışıngeçirmez
radyoopasiteradiopacityışıngeçirmezlik
radyoproteksiyonradioprotectionışından korunum
radyoterapiradiotherapyışın sağaltımı
-rafi-rhaphy, -rrhaphycerrahi dikiş ör. anevrizmorafi
rafinerefinedarıtılmış
-raji-rhagiafazla akıntı, kanama ör. hemoraji
ralraleçıtırtı (akciğer)
randomrandomrastgele
randomizasyonrandomizationrastgeleleştirme
randomizerandomizedrastlantısal
rapel dozbooster dosepekiştirme dozu
RASrenin-angiotensin systemrenin-angiotensin sistemi
rasyoratiooran
rasyonrationgünlük besin
rasyonalizasyonrationalizationussallaştırma
rasyonalizmrationalismusculuk
rasyonelrationalakılcı, ussal
rasyonel düşüncerational thinkingakılcı düşünme
raşrashderi döküntüsü
RBBBright bundle branch blocksağ dal bloku
RBCred blood cell, erythrocytealyuvar
RCAright coronary arterysağ koroner arter, sağ taç atardamar
RCDPrhizomelic chondrodysplasia punctata rizomelik kondrodisplazi punktata 
RCMrestrictive cardiomyopathyrestriktif kardiyomiyopati, kısıtlayıcı yürek kas sayrılığı
RDSrespiratory distress syndromerespiratuvar distres sendromu, solunum sıkıntısı belirgesi
-re-rheaakma ör. rinore
re- re-tekrar, yeniden, geriye doğru ör. reaktivasyon
reabsorpsiyonreabsorptiongeri emilim
reagenreagentmiyar
reaksiyonreaction1.tepki 2.tepkime
reaksiyon formasyon reaction formationkarşıt tepki oluşturma
reaksiyon zamanıreaction timetepki zamanı
reaksiyonerreactionarytepkisel
reaktanreactanttepkimeye katılan
reaktifreactive1.tepkili 2.ayıraç
reaktif depresyonreactive depressiontepkisel çökkünlük
reaktivasyonreactivationyeniden etkinleştirme
reaktivitereactivitytepkililik
realiterealitygerçeklik
realite prensibireality principlegerçeklik ilkesi
realiteye adaptasyonreality adaptationgerçeğe uyum
real-timereal-time gerçek zamanlı
reanimasyonreanimationyeniden canlandırma
reboundreboundgeri tepim
recipientrecipientalıcı
recovery roomrecovery roomderlenme odası
redistribüsyonredistributionyeniden dağılım
redüksiyonreduction1.indirgeme 2.yerine yerleştirme
redüktanreductantindirgeyen
redüktereduced1.indirgenmiş 2.yerine yerleştirilmiş
redüktörreducerindirgeyici
reelrealgerçek
reentranreentrantyeniden giren
reentrireentryyeniden giriş
referansreferencekaynak
referans değerreference valuedayanak değer
referans fikrireference ideaüzerine alınma
referans sanrısıdelusion of referencealınma sanrısı
refleksreflextepke
refleksiyonreflection1. yansıma 2. derin düşünme
reflektörreflectoryansıtıcı
reflürefluxgeri kaçış
refraksiyonrefractionkırılma
refrakterrefractory1.yanıtsız 2.tepkisiz 3.duyarsız
refrakter periyotrefractory periodduyarsız dönem
regresifregressivegerileyici
regresyonregressiongerileme
regülasyonregulationdüzenleme, ayarlama
regülatörregulatory1.düzenleyici 2.ayarlayıcı
regüleregulatedayarlı, düzenli
regülerregulardüzenli
regürjitanregurgitantgeriakan
regürjitasyonregurgitationgeri akış
rehabilitasyonrehabilitationondurma
rehberguidekılavuz
rehidratasyonrehydrationyeniden sıvılanım
reinforcementreinforcementpekiştirme
rejeksiyonrejectiondoku reddi, organ reddi
rejenerasyonregenerationyenilenim
rejeneratifregenerativeyenileyen
rejimregimen1. diyet 2. uygulama biçimi, yönetme
rejyonalregionalbölgesel
rekalsifikasyonrecalcificationyeniden kireçlenme
rekanalizasyonrecanalizationyeniden yol açma
rekombinanrecombinant1. yeniden birleştirilmiş 2. genetik çeşitlendirilmiş
rekombinasyonrecombination1. yeniden birleştirme 2. genetik çeşitlendirme
rekompresyonrecompressionbası yineleme
rekonstrüksiyonreconstructionyeniden yapılandırma
rekonstrüktifreconstructiveyeniden yapılandırıcı
rekt- rect-düz ör. m. rectus abdominis
rektal rectal düz bağırsak (ilişkili)
rektal prolapsusrectal prolapsusdüz bağırsak sarkması
rekto-rect(o)-düz bağırsak
rektopeksirectopexydüz bağırsak askılaması
rektorajirectorrhagiadüz bağırsak kanaması
rektoselrectoceledüz bağırsak fıtığı
rektoskoprectoscopedüz bağırsak göreci
rektumrectumdüz bağırsak
rektusrectusdoğru, düz
rekürenrecurrentyineleyen
rekürensrecurrenceyinelenme
reliabilityreliabilitygüvenilirlik
reliability coefficientreliability coefficientgüvenilirlik katsayısı
REMrapid eye movementhızlı göz devinimi
remisyonremissionyatışma
remitanremittent1.aralıklı 2.alevlenme-sakinleşme
remitan ateşremittent feverbacaklı ateş
remodelingremodelingyeniden biçimlendirme
renkidneyböbrek
ren(o)- ren- böbrek ör. renal
renalrenalböb­rek (ilişkili)
renal kaliksrenal calyxböbrek çanağı
renal yetmezlikrenal failureböbrek yetmezliği
renografirenographyX-ışınlı böbrek görüntülemesi
reorganizasyonreorganizationyeniden düzenleme
reparasyonreparationonarım
reperfüzyonreperfusionyeniden kanlanma
repetitifrepetitiveyineleyen
replantasyonreplantation1.yerine takma 2.yeniden ekim
replasmanreplacementyerine koyma
replikasyonreplicationeşlenme
repolarizasyonrepolarizationyeniden kutuplanma
represörrepressorbastırıcı
represyonrepressionbastırma
reprezanterrepresenterilaç tanıtıcı
reprintreprinttıpkı basım
reprodüksiyonreproductionçoğalma, çoğaltım, üreme
reprodüktifreproductiveüreme (ilişkili)
repülsiyonrepulsion1.itme, 2.geri tepme, 3.uzaklaştırma
RESreticuloendothelial systemretiküloendoteliyal sistem
resenkronizasyonresynchronizationyeniden eş zamanlama
reseptivitereceptivityalabilirlik
reseptörreceptoralmaç
resesifrecessiveçekinik
resetresetyeniden kurma
resipianrecipientalıcı
resiprokalreciprocalkarşılıklı
resiprokasyonreciprocationkarşılıklı oluşma
respirasyonrespirationsolunum
respiratörrespiratorsolutucu
respiratuvarrespiratorysolunumsal
restenozrestenosisyeniden daralma
restless leg syndromerestless leg syndromehuzursuz bacak belirgesi
restorasyonrestorationonarım
restoratifrestorativeonarıcı
restriksiyonrestrictionkısıtlama
restriktifrestrictivekısıtlayıcı
restriktif kardiyomiyopatirestrictive cardiomyopathykısıtlayıcı yürek kas sayrılığı
resüsitasyonresuscitationyeniden canlandırma
retansiyonretention1.birikim 2.alıkonma
retardasyonretardation1.gerilik, 2.gecikme
retarderetardedgeri kalmış
retartretarduzun etkili
retikülerreticularağsı
retikülositreticulocyteağsı alyuvar
retikülümreticulumağcık
retinaretinaağ tabaka
retina dekolmanıretinal detachmentağ tabaka ayrılması
retinopatiretinopathyağ tabaka sayrılığı
retraksiyonretractionçekilme
retraktil testisretractile testisutangaç testis
retraktörretractorayırgaç
retransplantasyonretransplantationyeniden nakil
retro- retro-geri, geride, arkada ör. retroperiton
retrofarengealretropharyngealyutak arkası (ilişkili)
retrognatiretrognathiagerilek çene
retrogratretrogradegeriye doğru
retrograt amneziretrograde geriye doğru bellek yitimi
retrograt dejenerasyonretrograde degenerationgeriye doğru bozunma
retrograt ejakülasyonretrograde ejaculationgerisin geri boşalım
retrokavalretrocavalvena kava arkası (ilişkili)
retrokolisretrocollisarkaya boyun kasılması
retronazalretronasalburun arkası (ilişkili)
retroperiton retroperitoneumkarın zarı arkası
retroperitonealretroperitonealkarın zarı arkası (ilişkili)
retrospektif retrospective gerileyik
retrospektif çalışmaretrospective studygerileyik çalışma
retrospektif falsifikasyonretrospective falcificationgerileyik çarpıtma
retrosternalretrosternalgöğüs kemiği arkası (ilişkili)
retroversiyonretroversiongeriye dönüklük
reuptakereuptakegerialım
reusablereusabletekrar kullanılabilir
revaskülarizasyonrevascularizationyeniden damarlanma
reverberasyonreverberationyankılanma
reversreverseters
revers gruplamareverse typingters gruplama
reversibılreversiblegeri dönebilir
revirinfirmaryhasta bakım birimi (kurum)
revizyonrevisiongözden geçirme
rezeksiyonresectionkesip çıkarma
rezervreserveyedek
rezervuarreservoir1. depo 2. mikrop taşıyıcı
rezidüresiduekalıntı, artık
rezidüelresidualartakalan
rezistanresistantdirençli
rezistansresistancedirenç
rezolüsyonresolution1.çözülme 2.düzelme 3.çözünürlük
rezorpsiyonresorptiongeri emilim
RF1. romatoid factor 2. radiofrequency1. romatoit faktör 2. radyofrekans
RFIDradio frequency identificationradyofrekan identifikasyon, radyofrekanla tanımlama
RhRh factorRh faktörü
RIAradioimmunassay analysisradyoimmün analiz, radyoimmün çözümleme
RIMA right internal mammary arterysağ internal meme arteri, sağ iç meme atardamarı
RIPA radioimmune precipitation assayradyoimmün presipitasyon asseyi, radyoimmün çökelme tahlili
RITA right internal thoracic arterysağ internal torasik arter, sağ iç göğüs duvar atardamarı
RİAintrauterine devicerahim içi araç, dölyatağı içi araç
RİBArecombinant immunoblast analysisrekombinan immünoblast analiz, rekombinan immünoblast çözümleme
rigorrigorkatılık
rigor mortisrigor mortisölüm katılığı
rijiditerigidity1.katılık 2. kas sertliği 3. katı kişilik
rijitrigidsert
rimrimkenar
rin(o)- rhin-burun ör. rinit
RİND reversible ischemic neurologic deficitreversibıl iskemik nörolojik defisit, geri dönüşümlü nörolojik iskemik olay
ringringhalka
rinitrhinitisnezle
rino-rhino-burun
rinofarenksrhinopharynxgeniz
rinofonirhinophoniaburundan konuşma
rinolalirhinolaliaburundan konuşma
rinolitrhinolithburun taşı
rinolojirhinologyburun bilimi
rinoplastirhinoplastyburun düzeltimi
rinorajirhinorrhagiaburun kanaması
rinoskopirhinoscopyburun göreçleme
ritimrhythmdizem
ritmikrhythmicdizemli
rituelritualtörensi
rizo- rhizo-kök ör. rizotomi
RKPrhizomelic chondrodysplasia punctata rizomelik kondrodisplazi punktata 
RNAribonucleic acidribonükleik asit
RNNrecurrent neural networkyineleyen sinir ağı
rocker bottom feetrocker bottom feetyumru ayak
ROMrange of motioneklem hareket açıklığı
romatizmarheumatismyel
rombensefalonhindbrainarka beyin
ronflanronflantkaba ses
ronjörrongeur kopartıcı (alet)
ronkusrhoncushırıltı
rostrum rostrumgagamsı
rotasyonrotationdönme
rotatuvarrotatorydöner
rozaserosaceagül hastalığı
rozeola infantumroseola infantumaltıncı hastalık
rölaksrelaxedgevşek
rölaksanrelaxantgevşetici
rölaksasyon relaxationgevşeme
rölaksasyon terapisirelaxation therapygevşeme sağaltımı
rölapsrelapsedepreşme
rölatifrelativegöreceli
rölatif riskrelative riskgöreceli risk
rötarretardgecikme
Rptakealınız (reçete)
rpmrevolutions per minutedakika devir sayısı
RTradiotherapyradyoterapi, ışın sağaltımı
rt-PArecombinant tissue plasminogen activatorrekombinan doku plazminojen aktivatörü
RT-PCRreal-time polymerase chain reactiongerçek zamanlı polimeraz zincir tepkimesi
RTxrenal transplantationböbrek transplantasyonu, böbrek nakli
ruborruborkızarıklık
rudimenter rudimentary1. artık 2. gelişmemiş, güdük
ruh hâlimoodduygu durumu
ruhsal reprezantasyonpsychological representationruhsal temsilci
ruhsal travmapsychic traumaruhsal örselenme
rulmanroulement (Fr.)yuvarlanma
ruminasyonrumination1. geviş getirme 2. düşünüp durma
rutinroutinealışılagelen
rüptürruptureyırtılma
rüyadreamdüş
rüya analizidüş çözümlemesi
RVright ventriclesağ ventrikül, sağ karıncık
RVADright ventricular assist devicesağ ventrikül destek cihazı, sağ karıncık destek cihazı
Rxtakealınız
S1first heart soundbirinci yürek sesi
S2second heart soundikinci yürek sesi
S3third heart soundüçüncü yürek sesi
S4fourth heart sounddördüncü yürek sesi
SAsinoatrialsinoatriyal
sabitlik constancydeğişmezlik
sadistsadistelezer
sadizmsadismelezerlik
sadomazoşist ilişkisadomasochist relationshipelezer-özezer ilişki
sadomazoşizm sadomasochismelezerlik-özezerlik
saf eritroit aplazipure red cell aplasiasaf alyuvar üretmezliği
safrabileöd
sagital eksensagittal axisön-arka eksen
sağlık psikolojisihealth psychologysağlık ruhbilimi
SAHsubarachnoid hemorrhagesubaraknoit hemoraji, subaraknoit kanama
saksackese
SAKsubarachnoid hemorrhagesubaraknoit kanama
sakr- sacr-sağrıkemiği ör. sakralizasyon
sakrumsacrumsağrıkemiği
sakülsacculekesecik
sakülersaccularkeseleşmiş
salinphysiological salineserum fizyolojik
salpenj- salping-dölyatağı tüpü, salpenks ör. salpenjit
salpenkssalpinxdölyatağı tüpü
salvo salvoyaylım ateşi
SAMsystolic anterior motionsistolik öne hareket
sangui- sangui-kan, kanlı ör. sanguinopürülan
sanitasyonsanitationsağlıklama
santralcentralmerkezî
santrifügalcentrifugalmerkezkaç
santrifüjcentrifugedöndürayır (aygıt)
santripedalcentripetalmerkezcil
santro- centro-ortada bulunan ör. santromer
SAPstable angina pectorisstabil anjina pektoris, kararlı göğüs ağrısı (yürek)
SAPDcontinuous ambulatory peritoneal dialysissürekli ayakta periton diyalizi, sürekli ayakta karın zarından arıtım
sapr- sapr-çürüme, kokuşma ör. saprofit
saprofitsaprophyteçürükçül
sarko- musclekas ör. sarkolemma
sarkolemmasarcolemmakas zarı
sarkomsarcomakötücül mezankim uru
sarkopenisarcopeniakas azlığı
SARSsevere acute respiratory syndromeciddi akut solunum belirgesi
SARS coronavirussevere acute respiratory syndrome, SARS coronavirus, SARS-CoVağır akut solunum yetersizliği belirgesine nedenli koronavirüs
SARS-CoV-2severe acute respiratory syndrome coronavirus 2ciddi akut solunum belirgesi koronavirüs 2
SARTstereotactic ablative radiotherapysterotaktik ablatif radyoterapi, sterotaktik yok edici ışın sağaltımı
satelitsatelliteuydu
satürasyonsaturationdoygunluk
satüresaturateddoymuş
sayrıpatienthasta
SBEsubacute bacterial endocarditissubakut bakteriyel endokardit, az ivegen bakteriyel yürek iç katman yangısı
SBRTstereotactic body radiotherapysterotaktik vücut radyoterapisi, sterotaktik gövde ışın sağaltımı
scsubcutaneousderi altı
scabiesgale, scabiesuyuz
scanningscanningtarama
scatologyscatologydışkı bilgisi
SCD sudden cardiac deathani kardiyak ölüm, ani yürek ölümü
SCHschizophreniaşizofreni
schwannomaschwannomasinir dış kılıf iyicil uru
SCIDsevere combined immunodeficiencyağır birleşik bağışıklık yetersizliği
SD1. standard deviation 2. spatial disorientation 3. scleroderma1. standart deviyasyon, standart sapma 2. uzamsal yönelim bozukluğu, mekansal yönelim bozukluğu 3. skleroderma
SDHsubdural hematomasubdural hematom, beyin-omurilik sert zarı altı kan toplağı
seanssessionoturum
sebo- sebo- yağ ör. sebore
seçici mutizmselective mutismseçici konuşmazlık
sedanter hayatsedentary lifehareketsiz yaşam
sedasyonsedationsakinleştirme
sedatifsedativesakinleştirici
sedimantasyonsedimentation1.çökme 2.tortulaşma
sedimentsediment1.çökelti, 2.tortu
sefal- cephal- baş (ilişkili) ör. sefalik
sefalikcephalicbaş, başa ait
sefalometrecephalometerkafaölçer
sefalometricephalometrykafa ölçümü
sefalostatcephalostat kafa sabitleyici
segmentsegment1.bölüm 2.kesit 3.parça
segmentalsegmentalbölümlü
segmentasyonsegmentationbölümleme
sekanssequencedizi, sıra
sekelsequelahastalık kalıntısı
sekestrasyonsequestration1. kan göllenmesi 2. ayrıklaştırma 3. yıkılım
sekondersecondary1. ikincil 2. ilişkili
sekonder delüzyonsecondary delusionikincil sanrı
sekonder emosyonsecondary emotionikincil duygu
sekonder güdüsecondary motiveikincil güdü
sekonder kazançsecondary gainikincil kazanç
sekonder motivasyonsecondary motivationikincil güdü
sekonder seksüel karakterlersecondary sexual characteristicsikincil cinsel özellikler
sekonder süreç düşünmesecondary process thinkingikincil süreç düşünme
sekonder travmasecondary traumaikincil travma
sekonder zihin yetilerisecondary mental abilitiesikincil zihin yetileri
sekresyonsecretion1. salgılama 2. salgı
sekretagogsecretagoguesalgılatıcı
sekssex1.cinsiyet 2.eşey
seks steroitsex steroidcinsiyet steroidi
seks temelli davranışsex-typed behaviorcinsiyet temelli davranış
seksiyosectiokesi
seksiyonsectionbölüm
seksolojisexologyeşey bilimi
seksüalitesexualitycinsellik
seksüelsexualcinsel
seksüel disfonksiyonsexual dysfunctioncinsel işlev bozukluğu
seksüel istismarsexual abusecinsel istismar
seksüel kimliksexual identitycinsel kimlik
seksüel latanssexual latencycinsel gizillik
seksüel matüritesexual maturitycinsel olgunluk
seksüel mazoşizmsexual masochismcinsel özezerlik
seksüel sadizmsexual sadismcinsel elezerlik
seksüel saldırısexual assaultcinsel saldırı, tecavüz
sektörsectorkesim
sekundumsecundumikincil
seleksiyonselection1.seçme 2.ayıkla(n)ma 3.seçele
selektifselectiveseçici
selektiviteselectivityseçicilik
selektörselectorseçici
selfselföz, kendi
self imajself-imageöz algısı
self kontrolself-controlöz denetim
self medikasyonself-medicationöz sağaltım
self-assessmentself-assessmentöz değerlendirim
self-awarenessself-awarenessöz farkındalık
self-expandableself-expandablekendiliğinden genişleyebilen
self-identityself-identityöz kimlik
sellasellaeyer
sella tursika sella turcicaTürk eyeri
sellarsellareyersi
selülercellulargözesel
selülisidalcellulicidalgöze öldürücü etki
selülitcellulitisderi altı yangısı
semantik belleksemantic memoryanlam belleği
sembolsymbolsimge
semensemenersuyu
semi-semi- yarım ör. semisirküler
semikantitatifsemiquantitativeyarı nicel
semilünersemilunaryarım ay
seminal vezikülseminal vesicleersuyu keseciği
semipermeabılsemipermeableyarı geçirgen
semisirkülersemicircularyarım daire
semiyolojisemiologybelirti bilimi
sempat- sempath-otonom sinirlerin sempatik dalı ör. sempatektomi
sempatektomisympathectomysempatik sinir işlevsizleştirimi
sempatisympathyhoşduyum
sempatik sympathetic1.sempatik (sinir bilimi) 2.cana yakın
sempozyumsymposiumbilgi şöleni
semptomsymptombelirti
semptom kümesisymptom clusterbelirti kümesi
semptomatik symptomaticbelirtili
semptomatik tedavisymptomatic treatmentbelirti sağaltımı
semptomatolojisymptomatologybelirti bilimi
sendromsyndromebelirge
senilsenileyaşlı
senilitesenilityyaşlılık
senkop syncopebaygınlık
senkronsynchronouseş zamanlı
senkron nöral networksynchronous neural networkeş zamanlı sinir ağı
senkron transmisyonsynchronous transmissioneş zamanlı iletim
senkroniksynchronical eş zamanlı
senkronizasyonsynchronizationeş zamanlama
senkronizesynchronizedeş zamanlı
senkronizmsynchronismeş zamanlılık
sensasyonsensationduyum
sensesenseuyarı algılama
sensibilitesensibilityduyumsallık
sensitifsensitiveduyarlı
sensitif periyotsensitive periodduyarlı dönem
sensitivitesensitivityduyarlılık
sensitizasyonsensitizationduyarlılaşma
sensoriyel sensorialduyumsal
sensoriyel afazisensory aphasiaduyusal lisan yitimi
sensoriyel agnozisensorial agnosiaduyusal tanımazlık
sensory gatingsensory gatingduyusal kapılama
sensörsensorduyarga
sentetiksynthetic1. yapay 2. bileşimli
sentezsynthesisbireşim
-sentez-centesissıvı alımı ör. perikardiyosentez
sentilcentileyüzde birlik
sentinelsentinelnöbetçi
separasyonseparationayrılma
separasyon anksiyetesiseparation anxietyayrılık kaygısı
separatörseparatorayırıcı
sepsissepsiskan zehirlenmesi
septal defektseptal defectara bölme açıklığı
septasyonseptationbölmelenme
septat uterusseptate uterusbölmeli dölyatağı
septi- septi-yedi
septikseptic1.mikroplu 2.kuşkucu
septisemisepticemiakan zehirlenmesi
septo- septo-bölümleme ör. septostomi
septostomiseptostomyara bölme açımı
-septör-ceptoralmaç ör. adenoreseptör
septumseptumara bölme
serbest yüzen anksiyetefree-floating anxietyyüzer-gezer kaygı
serea fleksibilitecerea flexibilitas, waxy flexibilitasbalmumu esnekliği
serebellarcerebellarbeyincik (ilişkili)
serebello- cerebello-beyincik ör. serebellotalamik
serebellumcerebellumbeyincik
serebral cerebral beyin (ilişkili)
serebral dominanscerebral dominancebeyin baskınlığı
serebral palsicerebral palsybeyin felci
serebro- cerebro-beyin ör. serebrospinal
serebrovaskülercerebrovascularbeyin-damar (ilişkili)
serebrumcerebrumbeyin
serklajcerclageçemberleyerek sabitleme
sero- sero-serum ör. seroloji
serolojiserology1. serum bilimi 2. kan serum testi
serözserouskansulu
sertifikasyoncertificationbelgelendirme
serumserumkansuyu
serumencerumen, earwaxkulak kiri
servikalcervicalboyun (ilişkili)
servikal collarcervical collarboyunluk
servikal herniasyoncervical herniationboyun fıtıklaşması
serviko- cervico-boyun (omurga veya uterus) ör. servikodorsal, servikovezikal
servikscervix1. boyun 2. dölyatağı boynu
serviks utericervix uteridölyatağı boynu
servimetrecervimeterdölyatağı boynuölçer
sesamoitsesamoidsusamsı
sesilsessilesapsız
sestotcestodeşeritsi solucan
sezaryencesareankarından doğurtma
SFsaline solutionserum fizyolojik
sfenoidalsphenoidaltemel kemik, yarasa kemik (ilişkili)
sfenoitsphenoidtemel kemik, yarasa kemik (kafa)
sferiksphericalküremsi
sfero- sphero-küre ör. sferosit
sferoitspheroidküremsi
sferositspherocyteküremsi alyuvar
sfigmomanometresphygmomanometerkan basınçölçer
sfinktersphincterbüzgen
SFTpulmonary function testssolunum fonksiyon testleri
SGAsmall for gestational agegebelik yaşına göre küçük (bebek)
sheathsheathkılıf
shuntshuntşant
SIRSsystemic inflammatory response syndromesistemik enflamatuvar yanıt sendromu, sistemik yangısal yanıt belirgesi
sızıtingleince ağrı
siber fobicyberphobiasanal ortam korkusu
sibilan ralsibilant raleıslık sesi (akciğer)
sickle cell anemisickle cell anemiaorak gözeli kansızlık
-sidal-cidalöldürücü etki ör. bakterisidal
sider- sider- demir (ilişkili) ör. siderozis
sifilissyphilisfrengi
sigmoidoskop sigmoidoscopekıvrımlı kalın bağırsak göreci
sigmoidoskopisigmoidoscopekıvrımlı kalın bağırsak göreçleme
sigmoit sigmoid1.kıvrımlı kalın bağırsak (ilişkili) 2. “S” şeklinde
sikatriscicatrixyara izi
sikl(o)-cycl-döngü ör. siklopleji
siklikcyclicdöngüsel
siklotimicyclothymiadöngüsel ruh hali
siklotroncyclotronyüklü parçacık hızlandırıcı
sikluscycledöngü
sili-cili-kirpiksi ör. siliyer cisim
silyumciliumkirpik
simbiyotiksymbioticortakyaşar
simbiyozsymbiosisortak yaşam
simetrisymmetrybakışım
simetriksymmetricbakışımlı
simülasyonsimulation1. benzetim 2. sayrımsama
simülatörsimulatorbenzeteç
simüle hastasimulated patientsözde hasta
simültanesimultaneouseş zamanlı
sin- 1. sin- 2. syn-1. çukur ör. sinüzit 2. yapışık, beraber ör. sindaktili, sinestezi
sinapssynapsesinir kavşağı
sinaptogenezsynaptogenesissinir kavşağı gelişimi
sinartroz synarthrosis oynamaz eklem
sindaktilsyndactylyapışık parmak
sindaktilisyndactylyyapışık parmaklılık
sindesmozsyndesmosissinfibroz
sine-cine- hareket ör. sineanjiyografi
sine qua nonabsolute mustolmazsa olmaz
sinerjisynergy1. artı etki 2.yöndeş etki
sinerjiksynergic1.yöndeş etkili 2.artı etkili
sinerjistsynergist1. yöndeş etkin 2.artı etkin
sinerjizmsynergism1. yöndeş etkileme 2.artı etkileme
sinestezisynesthesiabirleşik duyu
sineşisynechiayapışıklık
singreftsyngrafttıpkı ikiz yaması
singulumcingulumkuşak, halka
sinisterleft1.sol 2.soldaki
sino-cyno-köpek ör. sinofobi
sinofobicynophobiaköpek korkusu
sinofrisynophrysbirleşik kaş
sinonimsynonymeş anlamlı
sinoviyasynoviaeklem sıvısı
sinoviyal eklemsynovial jointoynar eklem
sinoviyal sıvısynovial fluideklem sıvısı
sintaktik afazisyntactic aphasiasözdizimsel lisan yitimi
sintilasyonscintillationsaçılım
sinüssinuskovuk, kanal veya boşluk
sinüzoitsinusoidtoplardamar boşluğu
sinyalsignalim, sişaret
sirengo-syringo-tüp, kanal ör. sirengomiyeli
sirkadiyencircadiangünlük
sirkadiyen ritimcircadian rhythmgünlük dizem
sirkülasyoncirculationdolaşım, dolanım
sirkülercircular1. dairesel 2. iç yazım
sirküm-circuit-halka ör. sirkumfleks
sirkümdüksiyoncircumductionçember çizme
sirkümferansiyelcircumferentialçembersel
sirkümflekscircumflexdolanan
sirkümsizyon circumcisionsünnet
sirkümstansiyalitecircumstantialityçevresel konuşma
sist(o)-cyst-1. kese 2. mesane ör. sistosel
sistem systemdizge
sistematiksystematicdizgeli
sistematik desensitizasyonsystematic desensitizationaşamalı duyarsızlaştırma
sistematize delüzyonsystematized delusionsistemli sanrı
sistemiksystemic1.yaygın 2.tüm beden (ilişkili)
sistemik dolaşımsystemic circulationbüyük kan dolaşımı
sistemik sirkülasyonsystemic circulationbüyük kan dolaşımı
sistitcystitismesane yangısı
sistografi cystography mesane görüntülemesi
sistolsystoleyürek kasılımı
sistolik kan basıncısystolic blood pressurekasılım kan basıncı
sistometrecystometermesane işlevölçer
sistometricystometrymesane işlev ölçümü
sistoselcystocelemesane fıtığı
sistoskopcystoscopemesane göreci
sistostomicystostomymesane ağızlaştırması
sistoüretrograficystourethrographymesane-siyek yolu görüntülemesi
-sit 1. –cyte 2. -cide1. hücre ör. miyosit 2. kıran, öldüren ör. pestisit
sitasyoncitationgönderme, atıf
sito-cyto-göze, hücre ör. sitoplazma
sitofobisitophobiayeme korkusu
sitogenetikcytogeneticsgöze genetik bilimi
sitogenezcytogenesisgöze gelişimi
sitolizcytolysisgöze erimesi
sitolojicytologygöze bilimi
sitolojikcytologic göze bilimsel
sitolojik tetkikcytologic examinationgöze bilimsel inceleme
sitometricytometrygöze ölçümü
sitopatojenikcytopathogenicgözeyozlatan
sitopatolojicytopathologysayrıgöze bilimi
sitopenicytopeniakan göze azlığı
sitoplazmacytoplasmgöze sıvısı
sitotoksikcytotoxicgöze ağulayıcı
sitotoksisitecytotoxicitygöze ağulanması
situssituskonum
situs inversussitus inversusters konum
situs solitussitus solitusdoğru konum
-siya-cydurum, davranış ör. anoreksiya
siyal-sial- tükrük ör. siyalogog
siyalendoskopsialendoscopetükrük bezi kanal iç göreci
siyalendoskopisialendoscopytükrük bezi kanal iç göreçleme
siyalogogsialagoguetükürükartırır
siyalore sialorrheasalya artışı
siyano-cyano-mor, morarma ör. siyanotik
siyanotikcyanoticmorarmalı
siyanotik kalp hastalığıcyanotic heart diseasemorarmalı yürek sayrılığı
siyanozcyanosismorarma
siyataljiischialgiakalça siniri ağrısı
siyatikischiadic nervekalça siniri
SKAcerebral blood flowserebral kan akımı, beyin kan akımı
skabiyesscabiesuyuz
skalascaleölçek
skalpscalpsaçlı deri
skapulascapulakürek kemiği
skarscar, cicatrixyara izi
skar dokuscar tissueyara iyileşme dokusu
skato-scato- dışkı
skatolojiscatologydışkı bilgisi
skatomscatomadışkı topağı
skin tagskin tag, acrochordonderi çıkıntısı
skler(o)-sclero-sert ör. sklerozan
sklerascleragöz akı
skleroterapisclerotherapytoplardamarın sklerozanla kapatılması
sklerotiksclerotic sert (ilişkili)
sklerozsclerosis1. sertleşme 2. sertlik
sklerozansclerosingsertleştiren
skolyozscoliosisyana eğri omurga
-skop-scopegöreç ör. endoskop
skopi scopygöreçleme
-skopi-scopygöreçleme ör. gastroskopi
skorscoresayı
skorlamascoringsayılama
skot-scot-karanlık ör. skotom
skotomscotomakör alan
skrotumscrotum erbezi torbası
skuam-squam-pul ör. skuamosellüler
skuamözsquamousyassı
SLsublingualsublingual, dilaltı
SL-AVRsutureless aortic valve replacementdikişsiz aort kapak değişimi
slaytslidesaydam, yansı
SLEsystemic lupus erythematosussistemik lupus eritematozis
SMA1. superior mesenteric artery 2. spinal muscular atrophy1. süperiyor mezenterik arter, üst mezenterik atardamar 2. spinal müsküler atrofi, omurilik (ilişkili) kas erimesi
smirsmearyayma
SNserial numberseri numarası
snaresnarekapan
SOAİİnonsteroidal antiinflamatory drugsteroit olmayan antienflamatuvar ilaç, steroit olmayan yangıgiderir ilaç
sodomisodomyhayvan sevicilik
SOFAsequential organ failure assessmentardışık organ yetmezliği değerlendirme
sol ventrikül ejeksiyon fraksiyonuleft ventricular ejection fractionsol karıncık fırlatma yüzdesi
sol ventrikül kütle indeksileft ventricular mass indexsol karıncık kütle göstergesi
sol ventrikül sistolik disfonksiyonleft ventricular systolic dysfunctionsol karıncık sistolik işlev bozukluğu
sol ventriküler çıkım yoluleft ventricular outflow tractsol karıncık çıkım yolu
solitsolidkatı, katılık
solitersolitarytek
solübilitesolubilityçözülebilirlik
solüsyonsolutionçözelti
solventsolventçözücü
somat(o)-somat- beden ör. somatogenetik
somatiksomaticbedensel
somatik pasifliksomatic passivitybedensel edilgenlik
somatik sanrısomatic delusionbedensel sanrı
somatik tip sanrısal bozuklukdelusional disorder somatic typebedensel tip sanrısal bozukluk
somatizasyonsomatizationbedenselleştirme
somatizasyon bozukluğusomatization disorderbedenselleştirme bozukluğu
somatoformsomatoformbedensi
somatoform bozukluksomatoform disorderbedensi belirti bozukluğu
somatopagnozisomatotopagnosis, somatagnosiabeden tanımazlığı
somatosensoriyel kortekssomatosensorial cortexbeden-duyumsal korteks
somatotropinsomatotrophinbüyüme hormonu
somn(i)-somnia- uyku ör. somnolans, disomni
somnambulizmsomnambulismuyurgezerlik
somnografisomnographyuyku çizgelemesi
somnolanssomnolenceaşırı uyku eğilimi
sondacatheterdalgı
sonikatörultrasonic homogenizerultrasonik homojenizatör, sesötesi bağdaştırıcı
sono-sono-ses ör. sonogram
sonogramsonogramsesötesi görüntü
sosyal fobisocial phobiatoplum korkusu
sosyalizasyonsocializationtoplumsallaşma
sosyometrisociometrytoplumsal davranış ölçümü
sosyopatsociopathtoplum karşıtı kişi
SOYhealth literacysağlık okuryazarlığı
söl-coel- boşluk
SPAsalus per aqua, health from watersudan gelen sağlık
SpAspondyloartritisspondiloartrit
spacerspaceraracı tüp
spasyalspatial1.uzamsal 2. mekansal
spasyal dezoryantasyon spatial disorientationuzamsal yönelim bozukluğu, mekansal yönelim bozukluğu
spazmspasmkasılım
spazmodikspasmodickasılımlı
spazmolitikspasmolytickasılımçözer
spazmolizspasmolysiskasılım çözülmesi
SPBcerebral perfusion pressureserebral perfüzyon basıncı, beyin kanlanma basıncı
specific gravityspecific gravityözgül ağırlık
specimenspecimenparça örnek
SPECTsingle photon emission computerized tomographytek foton emisyon bilgisayarlı tomografi, tek foton saçılımlı bilgisayarlı kesitçekim
spektralspectralgörüntüsel
spektrofotometrespectrophotometerizgesel ışılölçer
spektrofotometrispectrophotometryizgesel ışıl ölçümü
spektroskopispectroscopyizgesel görüntüleme
spektrumspectrumçeşitlilik
spekulumspeculumaçgaç
spekülatifspeculative1.saptırıcı 2.kurgusal
spermspermatozoonergöze
sperm-sperm-ergöze ör. spermatogenez
spermatogenezspermatogenesisergöze yapımı
spermiyogramspermiogramergöze incelemesi
spesifikspecificözgül
spesifik fobispecific phobiaözgül korku
spesifik öğrenme bozukluğuspecific learning disorderözgül öğrenme bozukluğu
spesifikasyonspecification1.özgülleme 2.özgül özellik
spesifisitespecificityözgüllük
spesimenspecimenparça örnek
spinalspinal1. omurga (ilişkili) 2. dikensi
spinal kort kompresyonuspinal cord compressionomurilik basısı
spinal sinirler nervi spinalis, spinal nervesomurilik sinirleri
spinal stenozspinal stenozomurga kanalı darlığı
spinozspinousdikensi (çıkıntı)
spiralspiralsarmal
spiro-spiro- soluk ör. spirometre
spirometrespirometersolukölçer
spirometrispirometrysoluk ölçümü
splen-splen-dalak ör. splenomegali
splenektomi splenectomydalak çıkartımı
splenomegali splenomegalydalak büyüklüğü
splintersplinterkıymıksı
splinter hemorajisplinter hemorrhagekıymıksı kanama
splitsplit1.yarılma 2.çiftlenme 3.ince dilim
spondil(o)-spondyl- omur ör. spondilit
spondilitspondylitisomur yangısı
spondiloartropatispondiloartropathyomurga eklem sayrılığı
spondiloartrozspondyloartrosisomurga kireçlenmesi
spondilolistezisspondylolisthesisomur kayması
spondilolizisspondylolysisomurga yozlaşması
spondiloz(is)spondylosisomur kaynaşması
sponjiyözspongioussüngerimsi
sponjiyöz cisimcorpus spongiosumsüngersi cisim
spontanespontaneouskendiliğinden
sporadiksporadictek tük
spurspur1. mahmuz 2. mahmuzsu
SRSstereotactic radiosurgerysterotaktik ışın cerrahisi
SRTstereotactic radiotherapysterotaktik radyoterapi, sterotaktik ışın sağaltımı
SScsystemic sclerodermasistemik skleroderma
SSPEsubacute sclerosing panencephalitissubakut sklerozan panensefalit, az ivegen sertleştiren yaygın beyin yangısı
SSRIselective serotonin reuptake inhibitorsseçici serotonin gerialım engelleyicileri
SSScentral nervous systemsantral sinir sistemi, merkezî sinir sistemi
stabilstable1. kararlı 2. sabit
stabilitestabilitydengelilik
stabilizasyonstabilizationsabitleme, dengeleme
stabilizatörstabilizersabitleyen, dengeleyen
stabilometrestabilometerdengeölçer
stabilometristabilometrydenge ölçümü
stagestageevre
STAIstate-trait anxiety inventorydurum-sürekli kaygı envanteri
standardizasyonstandardizationölçünleme
standartstandardölçünlü
stand-bystand-byhazırda
standstillstandstillduraklama
stapes stapesüzengi kemiği
staplerstaplertel zımba, basardiker
startle hastalığıstartle diseaseirkilme sayrılığı
statikstaticdurağan
statik tremorpostural tremorduruş titremesi
status epileptikusstatus epilepticuskesintisiz sara nöbeti
stazstasisdurgunluk
steato-steato- yağ ör. steatore
steatohepatoz(is)steatohepatosis karaciğer yağlanması
steinstrassesteinstrasse taş yolu
stem cellstem cellkök göze
STEMIST-segment elevation myocardial infarctionST segment elevasyonlu miyokart enfarktüsü, ST segment yükselmeli yürek krizi
steno-steno-dar ör. stenokoryazi
stenozstenosisdarlık
stentstentkafesçik
stereo-stereo-üç boyutlu ör. stereotaksi
stereotipstereotypekalıp
stereotipikstereotypicbasmakalıp
stereotipik davranışstereotypical behaviorbasmakalıp davranış
sterilsterile1. mikropsuz 2. kısır (kadın)
sterilizasyonsterilization1. mikropsuzlaştırma 2. kısırlaştırma
sterilizatörsterilizatormikropsuzlaştırgaç
sterilizesterilizedmikropsuzlaş(tırıl)mış
stern(o)-stern- göğüs kemiği ör. sternotomi
sternotomisternotomygöğüs kemiği açımı
sternum sternumgöğüs kemiği
steto- steto- göğüs ör. stetoskop
stetoskopstethoscopedinleme aleti
stigmatizasyonstigmatizationdamgalama
stilestilekılavuz çubuk
stiloitstyloidçivimsi
stimülanstimulantuyarıcı
stimülasyonstimulationuyarım
stimülatörstimulatorelektriksel uyarıcı araç
stimülüsstimulusuyarı, uyaran
stomastomayapay ağız
stomatitstomatitisağız yangısı
stomato- stomato- ağız ör. stomatit
stomatositstomatocyteağızsı alyuvar
-stomi-stomyağızlaştırma ör. kolostomi
strabismusstrabismusşaşılık
stragnant hipoksistragnant hypoxiadurağan hipoksi
stratifikasyonstraficationkatmanlama
stresstressgerilim
striktürstricturedaralma
stripstripşerit
striyastretch mark, striaderi çatlağı
strokstrokeinme, vurum
stromastromadestek doku
structured interviewstructured interviewyapılandırılmış görüşme
strüktürstructureyapı
stunningstunningafallama
sub- sub-altında, az, düşük ör. subakut
subakutsubacuteaz ivegen
subaortiksubaorticaort kapak altı
subconscioussubconsciousbilinç altı
subduralsubduralbeyin-omurilik sert zarı altı
subklaviyen çalma sendromusubclavian steal syndrome subklaviyen çalma belirgesi
subkliniksubclinicalklinik belirtisiz
subkostalsubcostalkaburga altı
subkütansubcutaneousderi altı
subliminal algısubliminal perceptioneşik altı algı
sublüksasyonsubluxationyarı çıkık
submandibulersubmandibularalt çene altı
substitüsyonsubstitutionyerine koyma
substitüsyon tedavisisubstitution therapyyerine koyma sağaltımı
substratsubstrate1. etkilenen madde 2. ortam
subtipsubtypealt tip
subtotalsubtotaltam olmayan
subtraksiyonsubtractionçıkarma
subungualsubungualtırnak altı
suctionsuctionemme
suçluluk delüzyonudelusion of self-accusationöz suçlama sanrısı
sudor- sudor-ter ör. sudamina
suflmurmurüfürüm
suisitsuicideözkıyım
sujesubject1. özne 2. denek
sulkussulcusoluk
sumasyonsummationeklenme
supinsupine sırtüstü
supinasyonsupinationdışa dönme
suportif dokusupportive tissuedestek doku
supozituvarsuppositoryfitil
supp.suppositoryfitil
supra- supra-üstünde ör. supravalvüler
suprasternalsuprasternalgöğüs kemiği üstü
supravalvüler supravalvularkapak üstü
supraventrikülersupraventricularkarıncık üstü
supraventriküler taşikardisupraventricular tachycardiakarıncık üstü hızlı vuru
survivor suçluluğusurvivor guiltsağkalma suçluluğu
suspansuvar suspensoryasıcı
suşstrainsoy
sübjektifsubjectiveöznel
süblimasyonsublimationyüceltme
süjestibilitesuggestibilitytelkine yatkınlık
süjestiyonsuggestiondüşünce aşılama, telkin
sükroz sucrose, saccharoseçay şekeri
süperegosuperegoüstbenlik
süperenfeksiyonsuperinfectioneklenik bulaş
süperfisyelsuperficialyüzeysel, sığ
süperiorsuperiorüst, yukarı
süperiyorite kompleksisuperiority complexüstünlük karmaşası
süperpozisyonsuperposition binişim
süpervizörsupervisorgözetmen
süpresansuppressant, suppressivebaskılayıcı
süpresyonsuppressionbaskılama
sür- sur-aşırı ör. sürdozaj
sürekli anksiyetetrait anxietysüregen kaygı
sürfaktansurfactanyüzeyetkir
sürveysurveyanket, tarama
sürveyanssurveillancegözet-izle
sürvisurvivalsağkalım
sürvi oranısurvival rate sağkalım oranı
süspansiyonsuspensionasıltılı çözelti
süt çocuğuinfantbebek
sütürsuture1. dikiş 2. kafatası kemik eklemi
SVHcerebrovascular diseaseserebrovasküler hastalık, beyin damar sayrılığı
SVIstroke volume indexvurum hacim endeksi
SVKİleft ventricular mass indexsol ventrikül kütle indeksi, sol karıncık kütle göstergesi
SVOcerebrovascular accidentserebrovasküler olay, beyin-damar olayı
SVRsystemic vascular resistancesistemik vasküler rezistans, sistemik damar direnci
SVTsupraventricular tachycardiasupraventriküler taşikardi, karıncık üstü hızlı vuru
SYHchronic heart diseasesüregen yürek hastalığı
systolic anterior motionsystolic anterior motionsistolik anterior hareket, sistolik öne hareket
ŞABschizoaffective disorderşizoafektif bozukluk
şalazyonchalaziongözkapağı kisti
şartlanmaconditioningkoşullanma
şartlı tepkiconditioned responsekoşullu yanıt
şartlı uyaranconditioned stimuluskoşullu uyaran
şartsız tepkiunconditioned responsekoşulsuz yanıt
şartsız uyaranunconditioned stimuluskoşulsuz uyaran
şecerepedigreesoyağacı
şelatörchelatorşelatlayıcı
şelazyonchelationşelatlama, kıskaçlama, metal iyon-organik molekül bağlanması
şikâyetcomplaintyakınma
şilo-chylo-akkansı ör. şilotoraks
şilofajicheilophagiadudağını ısırma tiki
şilomikronchylomicronyağ zerreciği
şilotorakschylothoraxgöğüs boşluğu içi akkan
şilözchylousakkansı
şilürichyluriaakkanlı idrar
şisto- schisto- yarık ör. şistomeli
şistositschistocyteparçalanmış alyuvar
şizofreniform bozuklukschizophreniform disorderşizofrenimsi bozukluk
şizoit kişilikschizoid personalityiçe kapanık kişilik
şizoit kişilik bozukluğuschizoid personality disorderiçe kapanık kişilik bozukluğu
şuurconsciousbilinç
şüphesuspicionkuşku
T1MItype 1 myocardial infarctiontip 1 miyokart enfarktüsü, tip 1 yürek krizi
TAAthoraco-abdominal aortic aneurysmtorako-abdominal aort anevrizması, göğüs-karın ana atardamar balonlaşması
tabakalayerkatman
tabipphysician, doctorsagun
tablotable1.durum 2. çizelge
tabula rasatabula rasaboş levha
tahlilanalysisçözümleme, inceleme
TAKclean intermittent catheterizationtemiz aralıklı kateterizasyon, temiz aralıklı dalgılama
takdimpresentationsunum
takifilaksitachyphylaxisdirenç gelişimi
takipfollow-upizlem
taklitimitationöykünme
takofobitachophobiahız korkusu
takotsubo kardiyomiyopatisitakotsubo cardiomyopathy, broken heart syndrome, stress cardiomyopathy, apical ballooning syndromekırık kalp belirgesi
-taksi-taxisyönelim ör. kemotaksi
taksonomitaxonomybölümleme
taktil agnozitactile agnosiadokunma tanımazlığı
taktil halüsinasyontactile hallucinationdokunma varsanısı
talasemithalassemia, Mediterranean anemiaAkdeniz kansızlığı
talassofobi thalassophobiadeniz korkusu
talus talusaşık kemiği
tampontampon 1.tıkaç 2.baskıt 3. dengeleyici
tampon çözeltibuffer solution dengeleyici çözelti
tamponattamponadebaskılanma
tanatofobithanatophobiaölüm korkusu
tanatosthanatosölüm içgüdüsü
tandem mass spektrometritandem mass spectrometryardışık kütle izge ölçümü
tanjansiyalitetangentialityçevresel konuşma
tansiyon1. blood pressure 2. tension 1. kan basıncı 2. gerilim
tansiyon aletisphygmomanometerkan basınçölçer
tansiyon pnömotorakstension pneumothorax, pressure pneumothoraxbasınçlı göğüs boşluğu içi hava birikimi
tapotmantapotementtapışlama
tardif diskinezitardive dyskinesiageç devinim bozukluğu
tardif distonitardive dystoniageç gerim bozukluğu
tarsaltarsal1. göz kapağı sert dokusu (ilişkili) 2. ayak bileği (ilişkili)
tarsal tünel sendromutarsal tunnel syndromeayak bileğinde sıkışma belirgesi
tarso- tarso-1. göz kapağı ör. tarsorafi 2. ayak bileği ör. tarsotibiyal
tarsustarsus1. göz kapağı sert dokusu 2. ayak bilek kemikleri
taş(k)i- tachy-hızlı ör. taşikardi, takipne
taş(k)ikarditachycardiahızlı vuru
taş(k)ipnetachypneahızlı soluma
taşiaritmitachyarrhythmiadüzensiz hızlı dizem
taşifilaksitachyphylaxisdirenç gelişimi
TAVsingle lung ventilationtek akciğer ventilasyonu, tek akciğer solutumu
TAVİtranscatheter aortic valve implantationtranskateter aortik valf implantasyonu, dalgıyla aort kapak yerleştirme
TBtuberculosistüberküloz
TBHtraumatic brain injurytravmatik beyin hasarı
TBI1. total body irradiation 2. traumatic brain injury1. tüm beden ışınlaması 2. travmatik beyin hasarı
TDPfresh frozen plasmataze donmuş plazma
tedavitreatmentsağaltım
tedavi işbirliğitherapeutic alliancesağaltım işbirliği
tedavi kompliyansıtreatment compliancesağaltıma uyum
TEE transoesophageal echocardiographytransözofageal ekokardiyografi, yemek borusundan ekokardiyografi
tekniktechniqueuygulayım
tektoriyatectoriaçadır
telanjiyektazitelangiectasiakılcal damar genişlemesi
tele- tele-uzaktan, ötesinde, karşı uç ör. telekardiyogram, telefaz
telekardiyografitelecardiographyX-ışınlı yürek görüntülemesi
telekardiyogramtelecardiogramyürek filmi
telekonferansteleconferencesanal toplantı, teletoplantı
telemetretelemeteruzaklıkölçer
telemetritelemetryuzaklık ölçümü
telepatitelepathyuzak duyum
teleradyografiteleradiographyuzaktan (yaklaşık 2m) X-ışınlı görüntüleme
telesağlıktelehealthuzaktan sağlık
teletıptelemedicineuzaktan tıp
telo- thelo- meme başı ör. telotizm
temathemaanadüşünce, izlek
temaruzsimulation, malingeringsayrımsama
temporaltemporal1. şakak (ilişkili) 2.zamansal
temporal kemiktemporalşakak kemiği
temporo- temporo-şakakla ilişkili ör. temporofrontal
temyiz kudreticivil responsibilityayırtım gücü, hukuki ehliyet
tenarthenaraya dış kabartısı
tendontendonkiriş
tenezmtenesmusağrılı ıkınma, buruntu
tenoliztenolysiskiriş serbestleştilmesi
tenotomitenotomykas kirişi kesisi
TENStranscutaneous electrical nerve stimulationtranskütanöz elektriksel sinir stimülasyonu, deriden elektriksel sinir uyarımı
tensiletensilegerilim
tensile strengthtensile strengthgerilim gücü
tensile stresstensile stressgerilim direnci
tenyateniaabdestbozan, şerit (asalak)
tenyasitteniacideşeritkıran
tenyazisteniasisşerit sayrılığı
teoritheorykuram
teoriktheoreticalkuramsal
ter- ter-üç ör. tersiyer
terapitherapysağaltım
terapisttherapistsağaltman
terapötiktherapeuticsağaltıcı
teratojenteratogenöndölüte zararlı
teratojenite teratogenicityöndölüte zararlılık
termterm1. miat 2. belli dönem
term bebekterm infantmiadında bebek
termalthermal1. sıcak kaplıca suyu 2. ısı (ilişkili)
terminalterminalson
terminal dönemterminal phaseölümcül evre
terminal filumfilum terminaleomurilik uç bağı
terminasyonterminationsonlandırma
terminolojiterminologyterim bilimi
termo- thermo-sıcaklık ör. termoregülasyon
termodilüsyonthermodilutionsıcaklık seyreltme
termometrethermometersıcaklıkölçer
termometrithermometrysıcaklık ölçümü
termoregülasyonthermoregulationsıcaklık düzenlenim
termoregülatörthermoregulatorsıcaklıkdüzenler
termostatthermostatesıcaklıkdenetir
termoterapithermotherapysıcakla sağaltım
terörterrordehşet
tersiltertileüçte birlik
tersiyertertiaryüçüncül, üçüncü
testistestiserbezi
teşhisdiagnosistanı
tetanitetanykasınım
tetanostetanuskazıklı humma
tethered kort sendromutethered cord syndromegergin omurilik belirgesi
tetkikinvestigationaraştırma, inceleme
tetra- tetra- dört ör. tetroloji
tetralojitetralogy1. dörtlük 2. dörtleme
tetraplejitetraplegiadörtlü felç
TEVARthoracic endovascular aneurysm repairtorasik endovasküler aort anevrizma tamiri, damariçi göğüs ana atardamar baloncuk onarımı
TGtriglyceridetrigliserit
TGAtransposition of the greater arteriesbüyük arter transpozisyonu, büyük damarların karşılıklı yer değişimi
thresholdthresholdeşik değer
tıbbimedicaltıp (ilişkili)
tıbbi ilüstrasyonmedical illustrationtıbbi görselleme
TIDthree times a daygünde üç kez
TINAtranscutaneous blood gas monitortranskutanöz kan gazı monitörü
tıp doktoruphysician, doctorsagun
TISStherapeutic intervention scoring system1. terapötik girişimsel puanlama sistemi 2. girişim puanlama sistemi
TİAtransient ischemic attacktransient iskemik atak, geçici yetersiz kanlanma atağı
tibiyashinbonekaval kemiği
tibiyaltibialkaval kemiği (ilişkili)
tidaltidalgelgitsel
tidal volümtidal volumesoluk hacmi
tikticseğirti
tik bozukluğutic disorderseğirti bozukluğu
tilttilteğim
tilt table testtilt table testeğimli masa testi
-timi-thymiaduygu hâli ör. aleksitimi
timpaniktympanicorta kulak (ilişkili)
timpanizmtympanismdavulsu ses
timüsthymusuykuluk
tinnitustinnituskulak çınlaması
-tip-type biçim ör. genotip
tip I biastype I biasbirinci tür yanlılık
tip II biastype II biasikinci tür yanlılık
tipiktypicalözgün, olağan
tiro- thyro-kalkanbezi ör. tiroidektomi
tiroidektomithyroidectomykalkanbezi çıkartımı
tiroit bezithyroid glandkalkanbezi
tirotoksikthyrotoxickalkanbezi ağular
tirotoksikozthyrotoxicosiskalkanbezi ağulaması
TİTurinalysistam idrar tahlili, tam sidik incelemesi
titrasyontitrationeş değerleme
titretitereş derişim
titübasyontitubationtitrek baş
TLDthermoluminescent dosimetertermolüminesan dozimetre, termolüminesan ışınölçer
TLEtemporal lobe epilepsytemporal lop epilepsisi, şakak lop sarası
tmtumorur
TMStranscranial magnetic stimulationtranskraniyal manyetik stimülasyon, kafatasından manyetik uyarım
TMUtranscranial magnetic stimulationtranskraniyal manyetik uyarım, kafatasından manyetik uyarım
TNFtumor necrosis factortümör nekroz faktörü, ur doku ölüm etkeni
TOF1. tetrology of Fallot 2. tracheo-esophageal fistula1. Fallot tetralojisi, Fallot dörtlemesi 2. trakeoözofageal fistül, ana soluk borusu-yemek borusu arası kanal
tofüstophusyumru
token ekonomi sistemitoken economy systemödül biriktirme yöntemi
toko- toco-, toko-doğum ör. tokoliz
tokofobitokophobiadoğurma korkusu
tokolitiktokolyticdoğumdurduran
tokoliztokolysisdoğum durdurma
tokometretokometerdoğum kasılımıölçer
toksemitoxemiakan ağulanması
toksik toxicağulu
toksikoloji toxicologyağu bilimi
toksikoztoxicosisağulanma
toksintoxincanlı ağusu
toksinozistoxinosistoksin sayrılığı
toksisitetoxicityağulandırıcılık
toleranstolerance1. yanıtsızlık 2. katlanım
-tomi-tomykesaç ör. laparotomi
tomografitomographykesitçekim
tomoterapitomotherapykesitsağaltım
tontonetını, titrem
tonaltonaltınımsal
toniktonic1. gergili 2.güçlendirici
tonisitetonicitygergi
tonsiltonsilbademcik
tonsilektomitonsillectomybademcik çıkartımı
tonüstonuskas gerinimi
topikaltopicalyüzeysel
toplum kökenli pnömonicommunity-acquired pneumoniatoplum kökenli zatürre
topografitopographybölgesel anatomi çizgelemesi
torakalthoracalgöğüs (ilişkili)
torako- thoraco-göğüs ör. torakotomi
torakolomberthoracolumbarsırt-bel
torakoskopithoracoscopygöğüs boşluğu göreçleme
torakostomithoracostomygöğüs boşluğu ağızlaştırması
torakotomithoracotomygöğüs boşluğu açımı
toraksthoraxgöğüs boşluğu, göğüskafesi
torasentezthoracentesisakciğer zar sıvı alımı
torasik aortathoracic aortagöğüs ana atardamarı
torasik outlet sendromuthoracic outlet syndromegöğüskafesi çıkım belirgesi
torktorquedöndürme momenti
torsiyontorsionburulum
tortikolistorticolliseğri boyun
tortiyoztortuouskıvrımlı
tortiyozitetortuositykıvrımlılık
TOSthoracic outlet syndrometorasik outlet sendromu, göğüskafesi çıkım belirgesi
totaltotaltoplam
total situs inversussitus inversus totalistam ters konum
TÖEtransoesophageal echocardiographytransözofageal ekokardiyografi, yemek borusundan ekokardiyografi
TPMtemporary pacemaker geçici yürek pili
TPNtotal parenteral nutritiontotal parenteral nütrisyon, tümüyle damardan beslenme
TPVDAtotal venous return anomalytotal venöz dönüş anomalisi, tüm toplardamar dönüş sapaklığı
TRtricuspid regurgitationtriküspit regürjitasyonu, triküspit yetersizliği
trabekülasyontrabeculationbölmelenim
traittraitöznel yapı
trakeatracheaana soluk borusu
trakealtrachealana soluk borusu (ilişkili)
trakeittracheitisana soluk borusu yangısı
trakeo- tracheo-ana soluk borusu ör. trakeotomi
trakeostomitracheostomyana soluk borusu ağızlaştırması
trakeotomitracheotomyana soluk borusu açımı
traksiyontractionçekme, çekilme, çekme gücü
trakttractyol
trankilizantranquilizeryatıştırıcı
transtrancekendinden geçme
trans-trans-bir taraftan diğerine geçen, yoluyla ör. transkütan, transmüral, transkateter
transanülertransannularhalka içinden
transdermaltransdermalderi geçişli
transdüksiyontransductionileti
transdüsertransducerçevirgeç
transeksiyontransectionenine kesi
transfertransferaktarma
transferanstransferenceaktarım
transformasyontransformation1. yapısal değişim 2. dönüşüm
transfüzyontransfusionkan aktarımı
transgeniktransgenicgen aktarımlı
transittransitdoğrudan geçiş
transizyontransitiongeçiş, değişme
transizyoneltransitional1.değişici 2.geçici
transkatetertranscatheterdalgı içinden
transkripsiyontranscriptionkopyalama
transkütantranscutaneousderiden
transkütanöztranscutaneous deri geçişli
translokasyontranslocationyer değişim
translüminaltransluminaliç boşluktan
translüminasyontransilluminationışık geçirim
translüsentranslucentyarı saydam
transmembrantransmembranezardan
transmisyontransmission1. aşırtım 2. genetik aktarım 3. iletim
transmitertransmitteruyarı aktarıcı
transmüraltransmural1. duvartutan 2. duvardan
transözofagealtransesophagealyemek borusundan
transparantransparentsaydam
transplantasyontransplantationnakil
transporttransporttaşınım, taşıma
transport kuvöztransport incubatortaşıma yaşanağı
transpozisyontranspositionyer değişimi
transseksüeltranssexualdönme
transseptaltransseptalara bölmeden
transtorasiktransthoracicgöğüs duvarından
transverstransverse enine
trasetracingyol, iz
travaylabourdoğum eylemi
travestitransvestkarşı cins giyimli
travestizmtransvestismkarşı cins öykünmeciliği
travmatraumaörselenme
travmatiktraumaticörseleyici, yaralayıcı, sarsıcı
travmatik flashbacktraumatic flashbackörselenme çakıntısı
travmatizasyontraumatizationörselenme, yaralanma, sarsılma
treadmilltreadmillkoşu bandı
trematot trematodeyapraksı solucan
tremortremortitreme
trentFeğilim
trepopnetrepopnealateral dekübitiste soluk zorluğu
TRIMtransfusion-related immunomodulationtransfüzyon ilişkili bağışıklık uyumlaması
tri-tri-üç ör.trigon
triaksiyeltriaxialüç eksenli
triangülertriangularüçgenimsi
trifaziktriphasicüç evreli
trigeminal nevraljitrigeminal neuralgiabeşinci kafa çifti ağrısı
trigeminal sinirtrigeminal nervebeşinci kafa çifti
trigemine trigeminyüçlü, üçüz
trigemine ritimtrigeminal rhythmiki normal bir erken üçlü dizem
trigontrigoneüçgen
trigonosefalitrigonocephalyüçgen kafalılık
trigonosefaliktrigonocephalicüçgen kafalı
trik(o)-trich-saç ör. trikobezoar
trikobezoartrichobezoarsaç topağı
trikofajitrichophagiesaç yeme
trikofobitrichophobiasaç korkusu
trikotilomanitrichotillomaniasaç yolma saplantısı
trilthrillelle hissedilen titreşim, ele gelen titreşim
trilojitrilogyüçlük
trimestertrimesterüç ay
triplet vurutriplet ectopic beatsüçlü erken vuru
trismustrismusçene kilitlenmesi
triyajtriageöncelikleme
triyat triadüçlü
trizomitrisomyüçlü kromozom
-trofi-trophybeslenme veya büyüme ör. hipertrofi, atrofi
trokantertrochanteruyluk kemik yumrusu
trokartrocardeleç
trokleartrochlear, ginglymusmakaramsı
trokoittrochoidsilindirik
trombektomithrombectomykan pıhtısı çıkartımı
trombo-thrombo-pıhtı ör. trombektomi
tromboembolektomithromboembolectomypıhtı tıkacı çıkartımı
tromboembolikthromboembolicpıhtı tıkanır
tromboembolizmthromboembolismpıhtı tıkanımı
trombofilithrombophiliapıhtılaşmaya eğilim
tromboflebitthrombophlebitispıhtılı toplardamar yangısı
trombojenikthrombogenicpıhtıoluşturur
trombojenitethrombogenicitypıhtılaştırıcılık
trombolitikthrombolyticpıhtıeritir
trombolizthrombolysispıhtı erimesi
tromboplastikthromboplasticpıhtılaştırıcı
trombositthrombocyte, plateletpulyuvar
trombositopenithrombocytopeniapulyuvar azlığı
trombositozthrombocytosispulyuvar artışı
trombozthrombosepıhtı tıkaç oluşumu
trombüsthrombuspıhtı topağı
-tropi-tropia1.sapma ör. ektopi 2.uyarma ör. inotropi
trunkaltruncalgövdesel
trunkustruncusgövde
TStricuspid stenosistriküspit stenozu, triküspit darlığı
TSHthyroid stimulating hormonetiroit stimülatör hormon, tiroit uyarıcı hormon
TSİcomplete urinalysistam sidik incelemesi
TTEtransthoracic echocardiographytranstorasik ekokardiyografi, göğüs duvarından ekokardiyografi
TTPthrombotic trombocytopenic purpuratrombotik trombositopenik purpura, tıkayıcı pulyuvar azlığı kanaması
tubatubatüp
tuba uterinatuba uterinadölyatağı tüpü
tubo-tubo-boru ör. tuboplasti
tumortumorşişlik
tunikalayerkatman
TURtransurethral resectiontransüretral rezeksiyon, siyek yoluyla çıkarım
turgorturgorgergi, dolgunluk
turniketourniqueboğmaç
TUSexamination for specialty in medicinetıpta uzmanlık sınavı
tuşetouchdokunum
tüberkülin testituberculinPPD testi
tüberküloittuberculoidkabarıksı
tüberküloztuberculosisverem
tüberküloz lenfadenopatituberculous lymphadenopathysıraca
tübültubuleborucuk
tübülertubularborucuksu
tümörtumorur
tümör lizis sendromutumor lysis syndrometümor yıkım belirgesi
tümöraltumoralura benzer
türbülanturbulantburgaçlı
türbülansturbulenceburgaç
TVRtricuspid valve replacementtriküspit valf replasmanı, triküspit kapak değişimi
Tx1. transplantation 2. therapy1. organ nakli, organ aktarımı 2. sağaltım
TYtricuspid insufficiencytriküspit yetersizliği
UFHunfractionated heparinfraksiyone olmayan hepain, tek doz heparin
uğraş terapisioccupational therapyuğraş sağaltımı
ulkusulcusyara
ulnaulnadirsek kemiği
ultra-ultra-ötesinde, ilerisinde, aşırı, altında ör. ultrafiltrasyon, ultrason, ultrastrüktürel, ultraviyole
ultrafiltrasyonultrafiltrationince süzme
ultrafiltratultrafiltrateince süzüntü
ultrasonultrasound1. sesötesi 2. sesötesi göreçleme
ultrasonikultrasonicsesötesi (ilgili)
ultrasonografultrasonographsesötesi göreci
ultrasonografiultrasonographysesötesi göreçleme
ultrasonogramultrasonogramsesötesi görüntü
ultrastrüktürultrastructureince yapı
ultraviyoleultravioletmorötesi
umbili-umbili-göbek ör. umbilikal
umbilikalumbilicalgöbek, göbeğe ait
umbilikal herniumbilical herniagöbek fıtığı
umbilikal kortumbilical cordgöbek bağı
umbilikal kort prolapsusuumbilical cord prolapsegöbek bağı sarkması
umbilikusumbilicusgöbek çukuru
unconsciousunconsciousbilinç dışı
undoingundoingyapma-bozma
unstructured interviewunstructured interviewyapılandırılmamış görüşme
upregulationupregulationartarak düzenlenim
uptakeuptaketutulum
uroflowuroflowidrar akımı
USultrasoundultrason, ultrasonografi, sesötesi, yansılanım
us yürütmereasoninguslamlama
USAPunstable angina pectorisanstabil anjina pektoris, kararsız göğüs ağrısı (yürek)
utero-utero-dölyatağı ör. uterovajinal
uterusuterusdölyatağı
uterus hipoplazisiuterine hypoplasiatam gelişmemiş dölyatağı
UVultravioletultraviyole, morötesi
uvulauvula1. küçük dil 2. dilcik
uvula palatinauvula palatinaküçük dil
uygunsuz afektincongruent affectuygunsuz duygulanım
uyku hijyenisleep hygieneuyku sağlığı
uyku paralizisisleep paralysisuyku felci
uyku-apne sendromusleep apnea syndromeuykuda soluk durma belirgesi
uyku-uyanıklık siklususleep-wake cycleuyku-uyanıklık döngüsü
uzman hekimspecialistuzsagun
uzuvorganorgan
ülserulceryara
üni-uni- tek, bir ör. ünilateral, ünivaryant
üniaksiyeluniaxialtek eksenli
ünidireksiyonelunidirectionaltek yönlü
ünifokalunifocaltek odaklı
üniformuniformtek biçimli
ünilateralunilateraltek taraflı
ünipolarunipolartek kutuplu
üniteunitbirim
ünivalanunivalenttek değerlikli
ünivaryantunivarianttek değişkenli
üniversaluniversalevrensel
üreterureteridrar borusu
üretero- uretero-idrar borusu ör. üreterosel
üreteroskopureteroscopeidrar borusu göreci
üretraurethra siyek
üretriturethritissiyek yangısı
üretro- urethro-siyek ör. üretrit
ürik- uric-idrar asidi ör. ürikozüri
üriner inkontinansurinary incontinenceidrar kaçırma
üriner kontinansurinary continenceidrarını tutabilme
üro- uro-idrar, boşaltım sistemi (ilişkili) ör. ürografi
ürodinamiurodynamicsboşaltım devinimselliği
üroflometreuroflowmeteridrar akımölçer
üroflometriuroflowmetryidrar akım ölçümü
ürografiurographyboşaltım sistemi görüntülemesi
ürolitiyazisurolithiasisidrar taşı sayrılığı
ürostomiurostomyidrar yolu ağızlaştırması
ürtikerurticariakurdeşen
ÜSGEupper gastrointestinal system endoscopyüst gastrointestinal sistem endoskopisi, üst sindirim sistemi iç göreçlemesi
üst ekstremiteupper extremitykol
üst uzmanlıksubspecialityyan dal uzmanlığı
ÜSYEupper respiratory tract infectionüst solunum yolu enfeksiyonu
ütilizasyonutilizationkullanım
ÜTSproduct tracking systemürün takip sistemi
v.veinven, toplardamar
VACvacuum assisted closurevakum yardımlı yara kapatma, negatif basınçlı yara kapatma
vagina synovialissynovial sheathsinoviyal kın
vajinavagina1. dölyolu 2. kılıf, kın
vajinal süpozituvarovuledölyolu fitili
vajinismusvaginismusdölyolu kasılması
VAKvacuum assisted closurevakum yardımlı yara kapatma, negatif basınçlı yara kapatma
vakacaseolgu
vaka raporucase reportolgu yazanağı
vaksinvaccineaşı
vaksinasyonvaccinationaşılama
vakumvacuumhavasız boşluk
vaküolvacuolekoful
valansvalencedeğer, değerlik
valfvalvekapak
valgusvalgusdışa çarpıklık
validasyonvalidationgeçerleme
validitevaliditygeçerlilik
valv- valv-kapak ör. valvülotomi
valvotomivalvotomy kapakçık kesimi
valvülvalvulekapakçık
valvülitvalvulitisyürek kapağı yangısı
valvülotomivalvulotomykapakçık kesimi
vanishing twin syndromevanishing twin syndromekaybolan ikiz belirgesi
vaporizasyonvaporizationbuharlaş(tır)ma
vaporizatörvaporizerbuharlaştırıcı (aygıt)
varisvarix (varices)toplardamar genişlemesi
varusvarusiçe çarpıklık
varyabilitevariabilitydeğişebilirlik
varyablvariabledeğişken
varyansvariancedeğişkenlik
varyantvariantdeğişken
varyasyonvariationdeğişik
vas deferensvas deferensergöze kanalı
vasatmediabesiyeri, ortam, orta
vaskülarizasyonvascularizationdamarlanma
vaskülervascular1. damarlı oluşum 2. damarsal
vaskülitvasculitisdamar yangısı
vaskülogenezvasculogenesisdamar gelişimi
VATSvideo assisted thoracoscopic surgeryvideo yardımlı göğüs boşluğu göreçleme cerrahisi
vazektomivasectomykısırlaştırma (erkek)
vazo- vaso-kanal, damar ör. vazospazm
vazoaktifvasoactivedamar etkinleştirici
vazodepresörvasodepressordamar baskılayıcı
vazodilatasyonvasodilatationdamar genişlemesi
vazodilatörvasodilatordamar genişletici
vazokonstriksiyonvasoconstrictiondamar büzülmesi
vazokonstriktörvasoconstrictordamar büzücü
vazomotorvasomotordamar devinimsel
vazopresinvasopressinantidiüretik hormon
vazopresörvasopressordamar basınç artırıcı
vazorölaksanvasorelaxantdamar gevşetici
vazorölaksasyonvasorelaxationdamar gevşemesi
vazospazmvasospasmani damar kasılması
VBAvertebrobasillar arteryvertebrobaziler arter
VCvital capacityvital kapasite, yaşamsal sığa
VCIvena cava inferiorvena kava inferior, alt ana toplardamar
VCSvena cava superiorvena kava süperior, üst ana toplardamar
VCSSvena cava superior syndromevena kava süperior sendromu, üst ana toplardamar belirgesi
VDRLvenereal disease research laboratoryzührevi hastalıklar araştırma laboratuvar testi
vebaplaguekara ölüm
vejetaryenvegeterianetyemez
vejetatifvegetativebitkisel
vejetatif hayatvegetative statebitkisel yaşam
vektörvector1. bileşke 2. yöney 3. taşıyıcı
velos